Neurokinin 1 Receptor (TACR1) (NM_015727) Human Tagged ORF Clone

SKU
RC212934
TACR1 (Myc-DDK-tagged)-Human tachykinin receptor 1 (TACR1), transcript variant short
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Neurokinin 1 Receptor
Synonyms NK1R; NKIR; SPR; TAC1R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212934 representing NM_015727
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATAACGTCCTCCCGGTGGACTCAGACCTCTCCCCAAACATCTCCACTAACACCTCGGAACCCAATC
AGTTCGTGCAACCAGCCTGGCAAATTGTCCTTTGGGCAGCTGCCTACACGGTCATTGTGGTGACCTCTGT
GGTGGGCAACGTGGTAGTGATGTGGATCATCTTAGCCCACAAAAGAATGAGGACAGTGACGAACTATTTT
CTGGTGAACCTGGCCTTCGCGGAGGCCTCCATGGCTGCATTCAATACAGTGGTGAACTTCACCTATGCTG
TCCACAACGAATGGTACTACGGCCTGTTCTACTGCAAGTTCCACAACTTCTTTCCCATCGCCGCTGTCTT
CGCCAGTATCTACTCCATGACGGCTGTGGCCTTTGATAGGTACATGGCCATCATACATCCCCTCCAGCCC
CGGCTGTCAGCCACAGCCACCAAAGTGGTCATCTGTGTCATCTGGGTCCTGGCTCTCCTGCTGGCCTTCC
CCCAGGGCTACTACTCAACCACAGAGACCATGCCCAGCAGAGTCGTGTGCATGATCGAATGGCCAGAGCA
TCCGAACAAGATTTATGAGAAAGTGTACCACATCTGTGTGACTGTGCTGATCTACTTCCTCCCCCTGCTG
GTGATTGGCTATGCATACACCGTAGTGGGAATCACACTATGGGCCAGTGAGATCCCCGGGGACTCCTCTG
ACCGCTACCACGAGCAAGTCTCTGCCAAGCGCAAGGTGGTCAAAATGATGATTGTCGTGGTGTGCACCTT
CGCCATCTGCTGGCTGCCCTTCCACATCTTCTTCCTCCTGCCCTACATCAACCCAGATCTCTACCTGAAG
AAGTTTATCCAGCAGGTCTACCTGGCCATCATGTGGCTGGCCATGAGCTCCACCATGTACAACCCCATCA
TCTACTGCTGCCTCAATGACAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212934 representing NM_015727
Red=Cloning site Green=Tags(s)

MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYF
LVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQP
RLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLL
VIGYAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLK
KFIQQVYLAIMWLAMSSTMYNPIIYCCLNDR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_015727
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015727.3
RefSeq Size 1268 bp
RefSeq ORF 936 bp
Locus ID 6869
UniProt ID P25103
Cytogenetics 2p12
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 35.5 kDa
Summary This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq, Sep 2008]
Write Your Own Review
You're reviewing:Neurokinin 1 Receptor (TACR1) (NM_015727) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212934L1 Lenti ORF clone of Human tachykinin receptor 1 (TACR1), transcript variant short, Myc-DDK-tagged 10 ug
$600.00
RC212934L2 Lenti ORF clone of Human tachykinin receptor 1 (TACR1), transcript variant short, mGFP tagged 10 ug
$600.00
RC212934L3 Lenti ORF clone of Human tachykinin receptor 1 (TACR1), transcript variant short, Myc-DDK-tagged 10 ug
$600.00
RC212934L4 Lenti ORF clone of Human tachykinin receptor 1 (TACR1), transcript variant short, mGFP tagged 10 ug
$600.00
RG212934 TACR1 (tGFP-tagged) - Human tachykinin receptor 1 (TACR1), transcript variant short 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC304352 TACR1 (untagged)-Human tachykinin receptor 1 (TACR1), transcript variant short 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.