DARPP32 (PPP1R1B) (NM_032192) Human Tagged ORF Clone

SKU
RC212689
PPP1R1B (Myc-DDK-tagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DARPP32
Synonyms DARPP-32; DARPP32
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212689 representing NM_032192
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCAAGGACCGCAAGAAGATCCAGTTCTCGGTGCCCGCGCCCCCTAGCCAGCTCGACCCCCGCC
AGGTGGAGATGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACC
AGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAAC
CCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCA
GCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCC
AAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAA
GTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGG
AGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACT
AAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212689 representing NM_032192
Red=Cloning site Green=Tags(s)

MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPN
PCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAE
VLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032192
ORF Size 612 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032192.4
RefSeq Size 1841 bp
RefSeq ORF 615 bp
Locus ID 84152
UniProt ID Q9UD71
Cytogenetics 17q12
Protein Families Druggable Genome
MW 22.8 kDa
Summary This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:DARPP32 (PPP1R1B) (NM_032192) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212689L1 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212689L2 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, mGFP tagged 10 ug
$600.00
RC212689L3 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212689L4 Lenti ORF clone of Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1, mGFP tagged 10 ug
$600.00
RG212689 PPP1R1B (tGFP-tagged) - Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126726 PPP1R1B (untagged)-Human protein phosphatase 1, regulatory (inhibitor) subunit 1B (PPP1R1B), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.