GGTLC1 (NM_178311) Human Tagged ORF Clone

SKU
RC212634
GGTLC1 (Myc-DDK-tagged)-Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GGTLC1
Synonyms dJ831C21.1; dJ831C21.2; GGTL6; GGTLA3; GGTLA4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212634 representing NM_178311
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTCCGAGTTCTTCTCTGCCCAGCTCCGGGCCCAGATCTCTGACGACACCACTCACCCGATCTCCT
ACTACAAGCCCGAGTTCTACATGCCGGATGACGGGGGCACTGCTCACCTGTCTGTGGTCGCAGAGGACGG
CAGTGCTGTGTCCGCCACCAGCACCATCAACCTCTACTTTGGCTCCAAGGTGCGCTCCCCAGTCAGCGGG
ATCCTGCTCAATAATGAAATGGATGACTTCAGCTCTACCAGCATCACCAACGAGTTTGGGGTACCCCCCT
CACCTGCCAATTTCATCCAGCCAGGGAAGCAGCCGCTCTCGTCCATGTGCCCGACGATCATGGTGGGCCA
GGACGGCCAGGTCCGGATGGTGGTGGGAGCTGCCGGGGGCACGCAGATCACCATGGCCACTGCACTGGCC
ATCATCTACAACCTCTGGTTCGGCTATGACGTGAAGTGGGCCGTGGAGGAGCCCCGGCTGCACAACCAGC
TTCTGCCCAACGTCACGACAGTGGAGAGAAACATTGACCAGGAAGTGACTGCAGCCCTGGAGACCCGGCA
CCATCACACCCAGATCACGTCCACCTTCATTGCTGTGGTGCAAGCCATCGTCCGCATGGCTGGTGGCTGG
GCAGCTGCCTCGGACTCCAGGAAAGGTGGGGAACCTGCTGGCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212634 representing NM_178311
Red=Cloning site Green=Tags(s)

MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSG
ILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALA
IIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGW
AAASDSRKGGEPAGY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178311
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178311.3
RefSeq Size 1049 bp
RefSeq ORF 678 bp
Locus ID 92086
UniProt ID Q9BX51
Cytogenetics 20p11.21
MW 24.1 kDa
Summary This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. In contrast, the product of this gene only contains homology to the light chain region, and lacks a transmembrane domain. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Oct 2008]
Write Your Own Review
You're reviewing:GGTLC1 (NM_178311) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212634L1 Lenti ORF clone of Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A, Myc-DDK-tagged 10 ug
$600.00
RC212634L2 Lenti ORF clone of Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A, mGFP tagged 10 ug
$600.00
RC212634L3 Lenti ORF clone of Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A, Myc-DDK-tagged 10 ug
$600.00
RC212634L4 Lenti ORF clone of Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A, mGFP tagged 10 ug
$600.00
RG212634 GGTLC1 (tGFP-tagged) - Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A 10 ug
$500.00
SC307148 GGTLC1 (untagged)-Human gamma-glutamyltransferase light chain 1 (GGTLC1), transcript variant A 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.