LILRA5 (NM_021250) Human Tagged ORF Clone

SKU
RC212310
LILRA5 (Myc-DDK-tagged)-Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LILRA5
Synonyms CD85; CD85F; ILT-11; ILT11; LILRB7; LIR-9; LIR9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212310 representing NM_021250
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCATGGTCTCATCCATCTGCACAGCTGCAGCCAGTGGGAGGAGACGCCGTGAGCCCTGCCCTCA
TGGTTCTGCTCTGCCTCGGGCTGAGTCTGGGCCCCAGGACCCACGTGCAGGCAGGGAACCTCTCCAAAGC
CACCCTCTGGGCTGAGCCAGGCTCTGTGATCAGCCGGGGGAACTCTGTGACCATCCGGTGTCAGGGGACC
CTGGAGGCCCAGGAATACCGTCTGGTTAAAGAGGGAAGCCCAGAACCCTGGGACACACAGAACCCACTGG
AGCCCAAGAACAAGGCCAGATTCTCCATCCCATCCATGACAGAGCACCATGCAGGGAGATACCGCTGTTA
CTACTACAGCCCTGCAGGCTGGTCAGAGCCCAGCGACCCCCTGGAGCTGGTGGTGACAGGATTCTACAAC
AAACCCACCCTCTCAGCCCTGCCCAGTCCTGTGGTGACCTCAGGAGAGAACGTGACCCTCCAGTGTGGCT
CACGGCTGAGATTCGACAGGTTCATTCTGACTGAGGAAGGAGACCACAAGCTCTCCTGGACCTTGGACTC
ACAGCTGACCCCCAGTGGGCAGTTCCAGGCCCTGTTCCCTGTGGGCCCTGTGACCCCCAGCCACAGGTGG
ATGCTCAGATGCTATGGCTCTCGCAGGCATATCCTGCAGGTATGGTCAGAACCCAGTGACCTCCTGGAGA
TTCCGGTCTCAGGAGCAGCTGATAACCTCAGTCCGTCACAAAACAAGTCTGACTCTGGGACTGCCTCACA
CCTTCAGGATTACGCAGTAGAGAATCTCATCCGCATGGGCATGGCCGGCTTGATCCTGGTGGTCCTTGGG
ATTCTGATATTTCAGGATTGGCACAGCCAGAGAAGCCCCCAAGCTGCAGCTGGAAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212310 representing NM_021250
Red=Cloning site Green=Tags(s)

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGT
LEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYN
KPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRW
MLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLG
ILIFQDWHSQRSPQAAAGR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021250
ORF Size 897 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021250.4
RefSeq Size 1365 bp
RefSeq ORF 900 bp
Locus ID 353514
UniProt ID A6NI73
Cytogenetics 19q13.42
MW 32.6 kDa
Summary The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:LILRA5 (NM_021250) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212310L3 Lenti ORF clone of Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC212310L4 Lenti ORF clone of Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 1, mGFP tagged 10 ug
$600.00
RG212310 LILRA5 (tGFP-tagged) - Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 1 10 ug
$500.00
SC304934 LILRA5 (untagged)-Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.