LILRA5 Rabbit Polyclonal Antibody

SKU
TA333401
Rabbit Polyclonal Anti-LILRA5 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-LILRA5 Antibody is: synthetic peptide directed towards the N-terminal region of Human LILRA5. Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 29 kDa
Gene Name leukocyte immunoglobulin like receptor A5
Database Link
Background The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
Synonyms CD85; CD85F; ILT-11; ILT11; LILRB7; LIR-9; LIR9
Note Immunogen sequence homology: Human: 100%; Bovine: 77%; Dog: 75%
Reference Data
Write Your Own Review
You're reviewing:LILRA5 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.