LILRA5 Rabbit Polyclonal Antibody

SKU TA333401

Rabbit Polyclonal Anti-LILRA5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LILRA5 Antibody is: synthetic peptide directed towards the N-terminal region of Human LILRA5. Synthetic peptide located within the following region: GNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: leukocyte immunoglobulin like receptor A5
• Database Link:
  NP_870994
  A6NI73
• Background: The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
• Synonyms: CD85; CD85F; ILT-11; ILT11; LILRB7; LIR-9; LIR9
• Note: Immunogen sequence homology: Human: 100%; Bovine: 77%; Dog: 75%

Reference Data