CEACAM7 (NM_006890) Human Tagged ORF Clone

SKU
RC212214
CEACAM7 (Myc-DDK-tagged)-Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CEACAM7
Synonyms CGM2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212214 representing NM_006890
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTCCCCTTCAGCCTGTCCATACAGAGTGTGCATTCCCTGGCAGGGGCTCCTGCTCACAGCCTCGC
TTTTAACCTTCTGGAACCTGCCAAACAGTGCCCAGACCAATATTGATGTCGTGCCGTTCAATGTCGCAGA
AGGGAAGGAGGTCCTTCTAGTAGTCCATAATGAGTCCCAGAATCTTTATGGCTACAACTGGTACAAAGGG
GAAAGGGTGCATGCCAACTATCGAATTATAGGATATGTAAAAAATATAAGTCAAGAAAATGCCCCAGGGC
CCGCACACAACGGTCGAGAGACAATATACCCCAATGGAACCCTGCTGATCCAGAACGTCACCCACAATGA
CGCAGGAATCTATACCCTACACGTTATAAAAGAAAATCTTGTGAATGAAGAAGTAACCAGACAATTCTAC
GTATTCTCGGAGCCACCCAAGCCCTCCATCACCAGCAACAACTTCAATCCGGTGGAGAACAAAGATATTG
TGGTTTTAACCTGTCAACCTGAGACTCAGAACACAACCTACCTGTGGTGGGTAAACAATCAGAGCCTCCT
GGTCAGTCCCAGGCTGCTGCTCTCCACTGACAACAGGACCCTCGTTCTACTCAGCGCCACAAAGAATGAC
ATAGGACCCTATGAATGTGAAATACAGAACCCAGTGGGTGCCAGCCGCAGTGACCCAGTCACCCTGAATG
TCCGCTATGAGTCAGTACAAGCAAGTTCACCTGACCTCTCAGCTGGGACCGCTGTCAGCATCATGATTGG
AGTACTGGCTGGGATGGCTCTGATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212214 representing NM_006890
Red=Cloning site Green=Tags(s)

MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG
ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFY
VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND
IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006890
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006890.5
RefSeq Size 2292 bp
RefSeq ORF 798 bp
Locus ID 1087
UniProt ID Q14002
Cytogenetics 19q13.2
MW 29.2 kDa
Summary This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:CEACAM7 (NM_006890) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC212214L1 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), Myc-DDK-tagged 10 ug
$750.00
RC212214L2 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), mGFP tagged 10 ug
$750.00
RC212214L3 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), Myc-DDK-tagged 10 ug
$750.00
RC212214L4 Lenti ORF clone of Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7), mGFP tagged 10 ug
$750.00
RG212214 CEACAM7 (tGFP-tagged) - Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) 10 ug
$489.00 MSRP $650.00 MSRP $650.00
SC303844 CEACAM7 (untagged)-Human carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM7) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.