MTP18 (MTFP1) (NM_001003704) Human Tagged ORF Clone

SKU
RC211840
MTFP1 (Myc-DDK-tagged)-Human mitochondrial fission process 1 (MTFP1), nuclear gene encoding mitochondrial protein, transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MTP18
Synonyms HSPC242; MTP18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211840 representing NM_001003704
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGAGCCGCAGCCGCGGGGCGCAGAGCGCGATCTCTACCGGGACACGTGGGTGCGATACCTGGGCT
ATGCCAATGAGGTGGGCGAGGCTTTCCGCTCTCTTGTGCCAGCGGCGGTGGTGTGGCTGAGCTATGGCGT
GGCCAGCTCCTACGTGCTGGCGGATGCCATTGACAAAGGCAAGAAGGCTGGAGAGGTCGGTGGATTTCCT
CCTGGACTCCAGCCTGCGCAAGCTCTACCCAACAGTGGGGAAGCCCAGCTCCTCCTGATCATACTCTGGT
ACCTGGCCTGTGCATCGGCCTCCTGCTTCATGTCAACCTCCTACTCCTGCCAGGGAATGTGGACACCTGG
CTCCCTGGTGTCCAAAGACCCTGGCACCTGGGTGGGTTTGAGCTGGACAGAAGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211840 representing NM_001003704
Red=Cloning site Green=Tags(s)

MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVGGFP
PGLQPAQALPNSGEAQLLLIILWYLACASASCFMSTSYSCQGMWTPGSLVSKDPGTWVGLSWTEA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001003704
ORF Size 405 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001003704.3
RefSeq Size 960 bp
RefSeq ORF 408 bp
Locus ID 51537
UniProt ID Q9UDX5
Cytogenetics 22q12.2
MW 14.3 kDa
Summary MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:MTP18 (MTFP1) (NM_001003704) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211840L3 Lenti ORF clone of Human mitochondrial fission process 1 (MTFP1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC211840L4 Lenti ORF clone of Human mitochondrial fission process 1 (MTFP1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged 10 ug
$450.00
RG211840 MTFP1 (tGFP-tagged) - Human mitochondrial fission process 1 (MTFP1), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$350.00
SC300528 MTFP1 (untagged)-Human mitochondrial fission process 1 (MTFP1), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.