TMPRSS3 (NM_032405) Human Tagged ORF Clone

SKU
RC211476
TMPRSS3 (Myc-DDK-tagged)-Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMPRSS3
Synonyms DFNB8; DFNB10; ECHOS1; TADG12
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211476 representing NM_032405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAAAATGATCCGCCTGCTGTTGAAGCCCCCTTCTCATTCCGATCGCTTTTTGGCCTTGATGATT
TGAAAATAAGTCCTGTTGCACCAGATGCAGATGCTGTTGCTGCACAGATCCTGTCACTGCTGCCATTGAA
GTTTTTTCCAATCATCGTCATTGGGATCATTGCATTGATATTAGCACTGGCCATTGGTCTGGGCATCCAC
TTCGACTGCTCAGGGAAGTACAGATGTCGCTCATCCTTTAAGTGTATCGAGCTGATAGCTCGATGTGACG
GAGTCTCGGATTGCAAAGACGGGGAGGACGAGTACCGCTGTGTCCGGGTGGGTGGTCAGAATGCCGTGCT
CCAGGTGTTCACAGCTGCTTCGTGGAAGACCATGTGCTCCGATGACTGGAAGGGTCACTACCCAAATGTT
GCCTGTGCCCAACTGGGTTTCCCAAGCTATGTGAGTTCAGATAACCTCAGAGTGAGCTCGCTGGAGGGGC
AGTTCCGGGAGGAGTTTGTGTCCATCGATCACCTCTTGCCAGATGACAAGGTGACTGCATTACACCACTC
AGTATATGTGAGGGAGGGATGTGCCTCTGGCCACGTGGTTACCTTGCAGTGCACAGCCTGTGGTCATAGA
AGGGGCTACAGCTCACGCATCGTGGGTGGAAACATGTCCTTGCTCTCGCAGTGGCCCTGGCAGGCCAGCC
TTCAGTTCCAGGGCTACCACCTGTGCGGGGGCTCTGTCATCACGCCCCTGTGGATCATCACTGCTGCACA
CTGTGTTTATGACTTGTACCTCCCCAAGTCATGGACCATCCAGGTGGGTCTAGTTTCCCTGTTGGACAAT
CCAGCCCCATCCCACTTGGTGGAGAAGATTGTCTACCACAGCAAGTACAAGCCAAAGAGGCTGGGCAATG
ACATCGCCCTTATGAAGCTGGCCGGGCCACTCACGTTCAATGGTACATCTGGGTCTCTATGTGGTTCTGC
AGCTCTTCCTTTGTTTCAAGAGGATTTGCAATTGCTCATTGAAGCATTCTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211476 representing NM_032405
Red=Cloning site Green=Tags(s)

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIH
FDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYPNV
ACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHR
RGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDN
PAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNGTSGSLCGSAALPLFQEDLQLLIEAFL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032405
ORF Size 1032 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032405.1, NP_115781.1
RefSeq Size 1359 bp
RefSeq ORF 1035 bp
Locus ID 64699
UniProt ID P57727
Cytogenetics 21q22.3
Domains ldl_recept_a, SR, Tryp_SPc
Protein Families Druggable Genome, Protease, Transmembrane
MW 37.3 kDa
Summary This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, an LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor-associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:TMPRSS3 (NM_032405) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211476L1 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D, Myc-DDK-tagged 10 ug
$757.00
RC211476L2 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D, mGFP tagged 10 ug
$757.00
RC211476L3 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D, Myc-DDK-tagged 10 ug
$757.00
RC211476L4 Lenti ORF clone of Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D, mGFP tagged 10 ug
$757.00
RG211476 TMPRSS3 (tGFP-tagged) - Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC316502 TMPRSS3 (untagged)-Human transmembrane protease, serine 3 (TMPRSS3), transcript variant D 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.