Gemin 2 (GEMIN2) (NM_003616) Human Tagged ORF Clone

SKU
RC211219
GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Gemin 2
Synonyms SIP1; SIP1-delta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211219 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCCGAGCGGAACTGGCTGGTTTGAAAACCATGGCGTGGGTACCAGCGGAGTCCGCAGTGGAAGAGT
TGATGCCTCGGCTATTGCCGGTAGAGCCTTGCGACTTGACGGAAGGTTTCGATCCCTCGGTACCCCCGAG
GACGCCTCAGGAATACCTGAGGCGGGTCCAGATCGAAGCAGCTCAATGTCCAGATGTTGTGGTAGCTCAA
ATTGACCCAAAGAAGTTGAAAAGGAAGCAAAGTGTGAATATTTCTCTTTCAGGATGCCAACCCGCCCCTG
AAGGTTATTCCCCAACACTTCAATGGCAACAGCAACAAGTGGCACAGTTTTCAACTGTTCGACAGAATGT
GAACAAACATAGAAGTCACTGGAAATCACAACAGTTGGATAGTAATGTGACAATGCCAAAATCTGAAGAT
GAAGAAGGCTGGAAGAAATTTTGTCTGGGTGAAAAGTTATGTGCTGACGGGGCTGTTGGACCAGCCACAA
ATGAAAGTCCTGGAATAGATTATGTACAAATTGGTTTTCCTCCCTTGCTTAGTATTGTTAGCAGAATGAA
TCAGGCAACAGTAACTAGTGTCTTGGAATATCTGAGTAATTGGTTTGGAGAAAGAGACTTTACTCCAGAA
TTGGGAAGATGGCTTTATGCTTTATTGGCTTGTCTTGAAAAGCCTTTGTTACCTGAGGCTCATTCACTGA
TTCGGCAGCTTGCAAGAAGGTGCTCTGAAGTGAGGCTCTTAGTGGATAGCAAAGATGATGAGAGGGTTCC
TGCTTTGAATTTATTAATCTGCTTGGTTAGCAGGTATTTTGACCAACGTGATTTAGCTGATGAGCCATCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211219 protein sequence
Red=Cloning site Green=Tags(s)

MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQ
IDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSED
EEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE
LGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003616
ORF Size 840 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003616.2, NP_003607.1
RefSeq Size 1368 bp
RefSeq ORF 810 bp
Locus ID 8487
UniProt ID O14893
Cytogenetics 14q21.1
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 31.6 kDa
Summary This gene encodes one of the proteins found in the SMN complex, which consists of several gemin proteins and the protein known as the survival of motor neuron protein. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:Gemin 2 (GEMIN2) (NM_003616) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC211219L1 Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, Myc-DDK-tagged 10 ug
$600.00
RC211219L2 Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, mGFP tagged 10 ug
$600.00
RC211219L3 Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, Myc-DDK-tagged 10 ug
$600.00
RC211219L4 Lenti ORF clone of Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha, mGFP tagged 10 ug
$600.00
RG211219 GEMIN2 (tGFP-tagged) - Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303357 GEMIN2 (untagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.