OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Isocitrate dehydrogenase (IDH1) (NM_005896) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210582
IDH1 (Myc-DDK-tagged)-Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA500610 Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Isocitrate dehydrogenase or NM_005896"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Isocitrate dehydrogenase
Synonyms HEL-216; HEL-S-26; IDCD; IDH; IDP; IDPC; PICD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210582 representing NM_005896
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCAAAAAAATCAGTGGCGGTTCTGTGGTAGAGATGCAAGGAGATGAAATGACACGAATCATTTGGG
AATTGATTAAAGAGAAACTCATTTTTCCCTACGTGGAATTGGATCTACATAGCTATGATTTAGGCATAGA
GAATCGTGATGCCACCAACGACCAAGTCACCAAGGATGCTGCAGAAGCTATAAAGAAGCATAATGTTGGC
GTCAAATGTGCCACTATCACTCCTGATGAGAAGAGGGTTGAGGAGTTCAAGTTGAAACAAATGTGGAAAT
CACCAAATGGCACCATACGAAATATTCTGGGTGGCACGGTCTTCAGAGAAGCCATTATCTGCAAAAATAT
CCCCCGGCTTGTGAGTGGATGGGTAAAACCTATCATCATAGGTCGTCATGCTTATGGGGATCAATACAGA
GCAACTGATTTTGTTGTTCCTGGGCCTGGAAAAGTAGAGATAACCTACACACCAAGTGACGGAACCCAAA
AGGTGACATACCTGGTACATAACTTTGAAGAAGGTGGTGGTGTTGCCATGGGGATGTATAATCAAGATAA
GTCAATTGAAGATTTTGCACACAGTTCCTTCCAAATGGCTCTGTCTAAGGGTTGGCCTTTGTATCTGAGC
ACCAAAAACACTATTCTGAAGAAATATGATGGGCGTTTTAAAGACATCTTTCAGGAGATATATGACAAGC
AGTACAAGTCCCAGTTTGAAGCTCAAAAGATCTGGTATGAGCATAGGCTCATCGACGACATGGTGGCCCA
AGCTATGAAATCAGAGGGAGGCTTCATCTGGGCCTGTAAAAACTATGATGGTGACGTGCAGTCGGACTCT
GTGGCCCAAGGGTATGGCTCTCTCGGCATGATGACCAGCGTGCTGGTTTGTCCAGATGGCAAGACAGTAG
AAGCAGAGGCTGCCCACGGGACTGTAACCCGTCACTACCGCATGTACCAGAAAGGACAGGAGACGTCCAC
CAATCCCATTGCTTCCATTTTTGCCTGGACCAGAGGGTTAGCCCACAGAGCAAAGCTTGATAACAATAAA
GAGCTTGCCTTCTTTGCAAATGCTTTGGAAGAAGTCTCTATTGAGACAATTGAGGCTGGCTTCATGACCA
AGGACTTGGCTGCTTGCATTAAAGGTTTACCCAATGTGCAACGTTCTGACTACTTGAATACATTTGAGTT
CATGGATAAACTTGGAGAAAACTTGAAGATCAAACTAGCTCAGGCCAAACTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210582 protein sequence
Red=Cloning site Green=Tags(s)

MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVG
VKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYR
ATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLS
TKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS
VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK
ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_005896
ORF Size 1242 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005896.4
RefSeq Size 2339 bp
RefSeq ORF 1245 bp
Locus ID 3417
UniProt ID O75874, A0A024R3Y6
Cytogenetics 2q34
Domains isodh
Protein Pathways Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways
MW 46.5 kDa
Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Sep 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005896" in other vectors (7)
SKU Description Size Price
RC210582L1 Lenti ORF clone of Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), Myc-DDK-tagged 10 ug
$986.00
RC210582L2 Lenti ORF clone of Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mGFP tagged 10 ug
$986.00
RC210582L3 Lenti ORF clone of Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), Myc-DDK-tagged 10 ug
$986.00
RC210582L4 Lenti ORF clone of Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1), mGFP tagged 10 ug
$986.00
RG210582 IDH1 (tGFP-tagged) - Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) 10 ug
$886.00
SC116430 IDH1 (untagged)-Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) 10 ug
$686.00
SC322129 IDH1 (untagged)-Human isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) 10 ug
$686.00

file-alt Citations

ATRX regulates glial identity and the tumor microenvironment in IDH-mutant glioma
Babikir, Wang, Shamardani et al
Genome Biol (2021) 22 (1), 311 DOI: 10.1186/s13059-021-02535-4
Cited by 52
AI Summary: OriGene products, specifically the IDH1R132H plasmid (CAT#: RC400096) and wildtype IDH1 plasmid (CAT#: RC210582), were used to transfect SB28 ATRX-KO cells, enabling the study of IDH1 mutations in the context of ATRX loss in glioma models.
Snippet: SB28 ATRX-KO cells were transfected with plasmids expressing either IDH1R132H (ORIGENE, CAT#: RC400096) or wildtype IDH1 (Origene CAT#: RC210582) and selected via neomycin. Cells were cultured in RPMI media supplemented with 10% FBS and 100
FigureFigureFigure
Targeted rescue of cancer-associated IDH1 mutant activity using an engineered synthetic antibody
Rizk, Mukherjee, Koide et al
Sci Rep (2017) 7 (1), 556 DOI: 10.1038/s41598-017-00728-1
AI Summary: OriGene contributed to this study by providing the human IDH1 plasmid, which was used to generate both wild-type and mutant (R132H) IDH1 constructs for protein expression and functional assays.
Snippet: protein interactions. Methods. IDH1 expression and purication. Human IDH1 plasmid was purchased from Origene. The WT and R132H constructs were cloned into pET25b(+) using NheI and NdeI restriction sites. Both the WT ... All 3 versions Cite SaveSaving
Isocitrate dehydrogenase mutations suppress STAT1 and CD8+ T cell accumulation in gliomas
Kohanbash, Carrera, Shrivastav et al
J. Clin. Invest. (2017)
AI Summary: OriGene products, specifically the scrambled shRNA plasmid (TR30013) and STAT1-targeting shRNA plasmids (TG502153), were used to manipulate STAT1 expression in glioma cells to study its role in immune gene regulation.
Snippet: ) RT-PCR analysis of Stat1, Cxcl9, and Cxcl10 expression in GL261WT cells stimulated with 10 ng/ml recombinant murine IFN-γ for 12 hours, 36 hours after transfection with 1 μg plasmid encoding either scrambled shRNA (OriGene Technologies;TR30013) or 4 shRNAs targeting STAT1 (OriGene Technologies;TG502153)
Registered report: IDH mutation impairs histone demethylation and results in a block to cell differentiation
Richarson, Scott, Zagnitko et al
Elife (2016) 5 DOI: 10.7554/eLife.10860
AI Summary: OriGene products, specifically the IDH1 ORF clone (RC210582), IDH1 R132H ORF clone (RC400096), and IDH2 ORF clone (RC201152), were used as expression constructs to replicate key experiments investigating how mutant IDH1/2 affects histone methylation and cell differentiation.
Snippet: IDH1 ORF clone, Nucleic acid, OriGene, RC210582, Replaces ATCC plasmid in pCMV-Sport6. IDH1 R132H ORF clone, Nucleic acid, OriGene, RC400096, Original generated by authors. IDH2 ORF clone, Nucleic acid, OriGene, RC201152, Replaces Invitrogen plasmid ... Cite SaveSaving
Mechanism for enhanced 5-aminolevulinic acid fluorescence in isocitrate dehydrogenase 1 mutant malignant gliomas
Kim, Cho, Xu et al
Oncotarget (2015) 6 (24), 20266-77 DOI: 10.18632/oncotarget.4060
Cited by 49
AI Summary: OriGene products contributed to this study by providing the IDH1 wild-type (RC213307) and IDH1 R132H mutant (RC400299) expression plasmids, which were used to generate genetically engineered glioma cell lines for investigating the relationship between IDH1 mutation status and 5-ALA fluorescence.
FigureFigureFigure
Metabolomic comparison between cells overexpressing isocitrate dehydrogenase 1 and 2 mutants and the effects of an inhibitor on the metabolism
Wen, Cho, Yun et al
J. Neurochem. (2014)
Cited by 17
AI Summary: OriGene contributed to this study by providing human IDH1 (NM_005896) and IDH2 (NM_002168) gene products, which were used to generate wild type and mutant constructs for transfection and subsequent metabolomic analysis.
Snippet: Lentiviral vector construction and preparation The genes for human IDH1 (GenBank accession number NM_005896) and IDH2 (GenBank accession number NM_002168) were obtained from Origene (Rockville, MD, USA), PCR-amplified and cloned into ... Cite SaveSaving
Showing 1-6 of 7 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products