CAPZB (NM_004930) Human Tagged ORF Clone

SKU
RC210480
CAPZB (Myc-DDK-tagged)-Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAPZB
Synonyms CAPB; CAPPB; CAPZ
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210480 representing NM_004930
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGATCAGCAGCTGGACTGTGCCTTGGACCTAATGAGGCGCCTGCCTCCCCAGCAAATCGAGAAAA
ACCTCAGCGACCTGATCGACCTGGTCCCCAGTCTATGTGAGGATCTCCTGTCTTCTGTTGACCAGCCACT
GAAAATTGCCAGAGACAAGGTGGTGGGAAAGGATTACCTTTTGTGTGACTACAACAGAGATGGGGACTCC
TATAGGTCACCATGGAGTAACAAGTATGACCCTCCCTTGGAGGATGGGGCCATGCCGTCAGCTCGGCTGA
GAAAGCTGGAGGTGGAAGCCAACAATGCCTTTGACCAGTATCGAGACCTGTATTTTGAAGGTGGCGTCTC
ATCTGTCTACCTCTGGGATCTGGATCATGGCTTTGCTGGAGTGATCCTCATAAAGAAGGCTGGAGATGGA
TCAAAGAAGATCAAAGGCTGCTGGGATTCCATCCACGTGGTAGAAGTGCAGGAGAAATCCAGCGGTCGCA
CCGCCCATTACAAGTTGACCTCCACGGTGATGCTGTGGCTGCAGACCAACAAATCTGGCTCTGGCACCAT
GAACCTCGGAGGCAGCCTTACCAGACAGATGGAGAAGGATGAAACTGTGAGTGACTGCTCCCCACACATA
GCCAACATCGGGCGCCTGGTAGAGGACATGGAAAATAAAATCAGAAGTACGCTGAACGAGATCTACTTTG
GAAAAACAAAGGATATCGTCAATGGGCTGAGGTCTGTGCAGACTTTTGCAGACAAATCAAAACAAGAAGC
TCTGAAGAATGACCTGGTGGAGGCTTTGAAGAGAAAGCAGCAATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210480 representing NM_004930
Red=Cloning site Green=Tags(s)

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDS
YRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDG
SKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHI
ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004930
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004930.5
RefSeq Size 1647 bp
RefSeq ORF 819 bp
Locus ID 832
UniProt ID P47756
Cytogenetics 1p36.13
Domains F_actin_cap_B
MW 30.4 kDa
Summary This gene encodes the beta subunit of the barbed-end actin binding protein, which belongs to the F-actin capping protein family. The capping protein is a heterodimeric actin capping protein that blocks actin filament assembly and disassembly at the fast growing (barbed) filament ends and functions in regulating actin filament dynamics as well as in stabilizing actin filament lengths in muscle and nonmuscle cells. A pseudogene of this gene is located on the long arm of chromosome 2. Multiple alternatively spliced transcript variants encoding different isoforms have been found.[provided by RefSeq, Aug 2013]
Write Your Own Review
You're reviewing:CAPZB (NM_004930) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210480L1 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210480L2 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1, mGFP tagged 10 ug
$600.00
RC210480L3 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC210480L4 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1, mGFP tagged 10 ug
$600.00
RG210480 CAPZB (tGFP-tagged) - Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC117036 CAPZB (untagged)-Human capping protein (actin filament) muscle Z-line, beta (CAPZB), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.