Protein kinase Y linked (PRKY) (NM_002760) Human Tagged ORF Clone

SKU
RC210438
PRKY (Myc-DDK-tagged)-Human protein kinase, Y-linked (PRKY)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Protein kinase Y linked
Synonyms OTTHUMP00000033227; protein kinase, Y-linked
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210438 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGCCCGGGCCGGCCCAGGCGGCCGCGGCGGAGAGCAACTCCCGAGAGGTGACGGAGGATGCCG
CCGACTGGGCGCCCGCGCTCTGCCCCAGCCCCGAGGCGCGGTCGCCGGAGGCGCCTGCCTACCGCCTGCA
GGACTGCGACGCGCTGGTCACCATGGGCACTGGGACGTTCGGGCGGGTGCACCTGGTGAAGGAGAAGACA
GCCAAGCATTTCTTCGCCCTCAAGGTGATGAGCATTCCCGACGTCATCCGCCGGAAGCAGGAGCAGCACG
TGCACAATGAGAAGTCTGTCCTGAAGGAAGTCAGCCACCCGTTCCTCATCAGGCTGTTCTGGACGTGGCA
TGAGGAGCGCTTCCTCTACATGCTCATGGAGTATGTGCCGGGTGGCGAGCTCTTCAGCTACCTGCGCAAC
CGGGGGCACTTCTCCAGCACCACGGGGCTCTTCTACTCTGCGGAGATCATCTGTGCCATTGAGTACCTGC
ACTCCAAGGAGATCGTCTACAGGGATTTGAAGCCGGAGAACATCCTGCTGGATAGGGATGGTCACATCAA
GCTCACGGACTTTGGGTTTGCCAAGAAGCTGGTAGACAGGACTTGGACCCTCTGTGGAACACCCGAGTAC
CTAGCCCCCGAAGTCATTCAGAGCAAGGGCCACGGAAGGGCCGTGGACTGGTGGGCCCTCGGCATCCTGA
TATTCGAGATGCTTTCGGGGTTTCCTCCATTTTTTGATGACAACCCGTTTGGCATTTATCAGAAAATTCT
TGCAGGCAAACTATATTTCCCCAGACATTTGGATTTCCATGTAAAAACGGGGCGAATGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210438 protein sequence
Red=Cloning site Green=Tags(s)

MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT
AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN
RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002760
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002760.3, NP_002751.1
RefSeq Size 7216 bp
RefSeq ORF 833 bp
Locus ID 5616
Cytogenetics Yp11.2
Domains pkinase, S_TKc, TyrKc
Protein Families Druggable Genome, Protein Kinase
MW 31.7 kDa
Summary This gene is similar to the protein kinase, X-linked gene in the pseudoautosomal region of the X chromosome. The gene is classified as a transcribed pseudogene because it has lost a coding exon that results in all transcripts being candidates for nonsense-mediated decay (NMD) and unlikely to express a protein. Abnormal recombination between this gene and a related gene on chromosome X is a frequent cause of XX males and XY females. [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:Protein kinase Y linked (PRKY) (NM_002760) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210438L1 Lenti ORF clone of Human protein kinase, Y-linked (PRKY), Myc-DDK-tagged 10 ug
$600.00
RC210438L2 Lenti ORF clone of Human protein kinase, Y-linked (PRKY), mGFP tagged 10 ug
$600.00
RC210438L3 Lenti ORF clone of Human protein kinase, Y-linked (PRKY), Myc-DDK-tagged 10 ug
$600.00
RC210438L4 Lenti ORF clone of Human protein kinase, Y-linked (PRKY), mGFP tagged 10 ug
$600.00
RG210438 PRKY (tGFP-tagged) - Human protein kinase, Y-linked (PRKY) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126856 PRKY (untagged)-Human protein kinase, Y-linked (PRKY) 10 ug
$300.00
SC323404 PRKY (untagged)-Kinase deficient mutant (K78M) of Human protein kinase, Y-linked (PRKY) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.