KRTAP9-3 (NM_031962) Human Tagged ORF Clone

SKU
RC210405
KRTAP9 (Myc-DDK-tagged)-Human keratin associated protein 9-3 (KRTAP9-3). Note: ORF is codon optimized
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KRTAP9-3
Synonyms KAP9.3; KRTAP9.3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210405 ORF sequence, codon optimized.
Due to the complexity of NM_031962, the ORF clone is codon optimized for mammalian Expression.
The nucleotide sequence differs from the reference sequence, yet the amino acid sequence remains identical
.

Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCACTGTTGCAGCCCTTGCTGCCAGCCAACGTGTTGCAGGACGACATGTTGGCAGCCTACCACCG
TTACTACCTGCTCATCAACCCCATGTTGCCAGCCTAGTTGTTGCGTTAGCAGCTGCTGCCAGCCCTGTTG
CCATCCTACCTGCTGCCAGAATACTTGCTGTAGGACCACTTGTTGCCAGCCTATATGCGTCACTTCCTGC
TGTCAACCTAGTTGCTGCTCAACTCCTTGCTGTCAACCTACATGCTGTGGGTCAAGTTGCGGCCAGTCTT
CCTCCTGTGCACCAGTGTATTGCAGGCGCACCTGTTACCATCCGACATCTGTATGCCTGCCGGGGTGTCT
GAATCAGTCCTGCGGGAGTAACTGCTGTCAGCCCTGTTGCAGACCTGCTTGCTGCGAGACAACATGTTGC
CGCACAACGTGCTTCCAGCCTACGTGCGTATACTCCTGTTGCCAGCCATCTTGTTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210405 representing NM_031962
Red=Cloning site Green=Tags(s)

MTHCCSPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCCQPCCHPTCCQNTCCRTTCCQPICVTSC
CQPSCCSTPCCQPTCCGSSCGQSSSCAPVYCRRTCYHPTSVCLPGCLNQSCGSNCCQPCCRPACCETTCC
RTTCFQPTCVYSCCQPSCC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031962
ORF Size 477 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031962.1, NM_031962.2, NP_114168.1
RefSeq Size 1020 bp
RefSeq ORF 480 bp
Locus ID 83900
UniProt ID Q9BYQ3
Cytogenetics 17q21.2
MW 16.9 kDa
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:KRTAP9-3 (NM_031962) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RG210405 KRTAP9 (tGFP-tagged) - Human keratin associated protein 9-3 (KRTAP9-3). Note: ORF is codon optimized 10 ug
$350.00
SC305381 KRTAP9 (untagged)-Human keratin associated protein 9-3 (KRTAP9-3) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.