CCR9 (NM_006641) Human Tagged ORF Clone

SKU
RC210246
CCR9 (Myc-DDK-tagged)-Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCR9
Synonyms CC-CKR-9; CDw199; GPR-9-6; GPR28
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210246 representing NM_006641
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACACCCACAGACTTCACAAGCCCTATTCCTAACATGGCTGATGACTATGGCTCTGAATCCACATCTT
CCATGGAAGACTACGTTAACTTCAACTTCACTGACTTCTACTGTGAGAAAAACAATGTCAGGCAGTTTGC
GAGCCATTTCCTCCCACCCTTGTACTGGCTCGTGTTCATCGTGGGTGCCTTGGGCAACAGTCTTGTTATC
CTTGTCTACTGGTACTGCACAAGAGTGAAGACCATGACCGACATGTTCCTTTTGAATTTGGCAATTGCTG
ACCTCCTCTTTCTTGTCACTCTTCCCTTCTGGGCCATTGCTGCTGCTGACCAGTGGAAGTTCCAGACCTT
CATGTGCAAGGTGGTCAACAGCATGTACAAGATGAACTTCTACAGCTGTGTGTTGCTGATCATGTGCATC
AGCGTGGACAGGTACATTGCCATTGCCCAGGCCATGAGAGCACATACTTGGAGGGAGAAAAGGCTTTTGT
ACAGCAAAATGGTTTGCTTTACCATCTGGGTATTGGCAGCTGCTCTCTGCATCCCAGAAATCTTATACAG
CCAAATCAAGGAGGAATCCGGCATTGCTATCTGCACCATGGTTTACCCTAGCGATGAGAGCACCAAACTG
AAGTCAGCTGTCTTGACCCTGAAGGTCATTCTGGGGTTCTTCCTTCCCTTCGTGGTCATGGCTTGCTGCT
ATACCATCATCATTCACACCCTGATACAAGCCAAGAAGTCTTCCAAGCACAAAGCCCTAAAAGTGACCAT
CACTGTCCTGACCGTCTTTGTCTTGTCTCAGTTTCCCTACAACTGCATTTTGTTGGTGCAGACCATTGAC
GCCTATGCCATGTTCATCTCCAACTGTGCCGTTTCCACCAACATTGACATCTGCTTCCAGGTCACCCAGA
CCATCGCCTTCTTCCACAGTTGCCTGAACCCTGTTCTCTATGTTTTTGTGGGTGAGAGATTCCGCCGGGA
TCTCGTGAAAACCCTGAAGAACTTGGGTTGCATCAGCCAGGCCCAGTGGGTTTCATTTACAAGGAGAGAG
GGAAGCTTGAAGCTGTCGTCTATGTTGCTGGAGACAACCTCAGGAGCACTCTCCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210246 representing NM_006641
Red=Cloning site Green=Tags(s)

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVI
LVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCI
SVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKL
KSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTID
AYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRRE
GSLKLSSMLLETTSGALSL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006641
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006641.1
RefSeq Size 2462 bp
RefSeq ORF 1074 bp
Locus ID 10803
UniProt ID P51686
Cytogenetics 3p21.31
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
MW 42.02 kDa
Summary The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the beta chemokine receptor family. Chemokines and their receptors are key regulators of thymocyte migration and maturation in normal and inflammation conditions. This gene is differentially expressed in T lymphocytes of the small intestine and colon, and its interaction with chemokine 25 contributes to intestinal intra-epithelial lymphocyte homing to the small intestine. This suggests a role for this gene in directing immune responses to different segments of the gastrointestinal tract. This gene and its exclusive ligand, chemokine 25, are overexpressed in a variety of malignant tumors and are closely associated with tumor proliferation, apoptosis, invasion, migration and drug resistance. This gene maps to the chemokine receptor gene cluster. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:CCR9 (NM_006641) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210246L1 Lenti ORF clone of Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B, Myc-DDK-tagged 10 ug
$757.00
RC210246L2 Lenti ORF clone of Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B, mGFP tagged 10 ug
$757.00
RC210246L3 Lenti ORF clone of Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B, Myc-DDK-tagged 10 ug
$757.00
RC210246L4 Lenti ORF clone of Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B, mGFP tagged 10 ug
$757.00
RG210246 CCR9 (tGFP-tagged) - Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC310507 CCR9 (untagged)-Human chemokine (C-C motif) receptor 9 (CCR9), transcript variant B 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.