Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Tagged ORF Clone

SKU
RC210245
CCL18 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Macrophage Inflammatory Protein 4
Synonyms AMAC-1; AMAC1; CKb7; DC-CK1; DCCK1; MIP-4; PARC; SCYA18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210245 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGCCTTGCAGCTGCCCTCCTTGTCCTCGTCTGCACCATGGCCCTCTGCTCCTGTGCACAAGTTG
GTACCAACAAAGAGCTCTGCTGCCTCGTCTATACCTCCTGGCAGATTCCACAAAAGTTCATAGTTGACTA
TTCTGAAACCAGCCCCCAGTGCCCCAAGCCAGGTGTCATCCTCCTAACCAAGAGAGGCCGGCAGATCTGT
GCTGACCCCAATAAGAAGTGGGTCCAGAAATACATCAGCGACCTGAAGCTGAATGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210245 protein sequence
Red=Cloning site Green=Tags(s)

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC
ADPNKKWVQKYISDLKLNA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002988
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002988.4
RefSeq Size 798 bp
RefSeq ORF 270 bp
Locus ID 6362
UniProt ID P55774
Cytogenetics 17q12
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
MW 9.8 kDa
Summary This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:Macrophage Inflammatory Protein 4 (CCL18) (NM_002988) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210245L1 Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), Myc-DDK-tagged 10 ug
$450.00
RC210245L2 Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mGFP tagged 10 ug
$450.00
RC210245L3 Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), Myc-DDK-tagged 10 ug
$450.00
RC210245L4 Lenti ORF clone of Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18), mGFP tagged 10 ug
$450.00
RG210245 CCL18 (tGFP-tagged) - Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) 10 ug
$489.00
SC303259 CCL18 (untagged)-Human chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) (CCL18) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.