RHEX (NM_001007544) Human Tagged ORF Clone

SKU
RC210024
C1orf186 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 186 (C1orf186)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RHEX
Synonyms C1orf186
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210024 representing NM_001007544
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGACAGAAGTCATGGAGGTCTGGCATGGCTTAGTGATCGCGGTGGTGTCCCTCTTCCTGCAGGCCT
GCTTCCTCACCGCCATCAACTACCTGCTCAGCAGGCACATGGCCCACAAGAGTGAACAGATACTGAAAGC
GGCCAGTCTCCAGGTTCCCAGGCCCAGCCCTGGCCACCATCATCCACCTGCTGTCAAAGAGATGAAGGAG
ACTCAGACAGAGAGAGACATCCCAATGTCTGATTCCCTTTACAGGCATGACAGCGACACACCCTCAGATA
GCTTGGATAGCTCCTGCAGTTCGCCTCCTGCCTGCCAGGCCACAGAGGATGTGGATTACACACAAGTCGT
CTTTTCTGACCCTGGAGAACTAAAAAATGACTCCCCGCTGGACTATGAGAACATAAAGGAAATCACAGAT
TATGTCAATGTCAATCCAGAAAGACACAAGCCCAGTTTCTGGTATTTTGTCAACCCTGCTCTGTCTGAGC
CAGCGGAATATGATCAAGTGGCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210024 representing NM_001007544
Red=Cloning site Green=Tags(s)

MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHHHPPAVKEMKE
TQTERDIPMSDSLYRHDSDTPSDSLDSSCSSPPACQATEDVDYTQVVFSDPGELKNDSPLDYENIKEITD
YVNVNPERHKPSFWYFVNPALSEPAEYDQVAM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001007544
ORF Size 516 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001007544.4
RefSeq Size 1665 bp
RefSeq ORF 519 bp
Locus ID 440712
UniProt ID Q6ZWK4
Cytogenetics 1q32.1
Protein Families Transmembrane
MW 19.2 kDa
Summary Acts as a signaling transduction factor of the EPO-EPOR signaling pathway promoting erythroid cell differentiation (PubMed:25092874).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RHEX (NM_001007544) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210024L1 Lenti ORF clone of Human chromosome 1 open reading frame 186 (C1orf186), Myc-DDK-tagged 10 ug
$600.00
RC210024L2 Lenti ORF clone of Human chromosome 1 open reading frame 186 (C1orf186), mGFP tagged 10 ug
$600.00
RC210024L3 Lenti ORF clone of Human chromosome 1 open reading frame 186 (C1orf186), Myc-DDK-tagged 10 ug
$600.00
RC210024L4 Lenti ORF clone of Human chromosome 1 open reading frame 186 (C1orf186), mGFP tagged 10 ug
$600.00
RG210024 C1orf186 (tGFP-tagged) - Human chromosome 1 open reading frame 186 (C1orf186) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC301238 C1orf186 (untagged)-Human chromosome 1 open reading frame 186 (C1orf186) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.