PTP4A2 (NM_080391) Human Tagged ORF Clone

SKU
RC209983
PTP4A2 (Myc-DDK-tagged)-Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PTP4A2
Synonyms HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209983 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCGTCCAGCCCCTGTGGAGATCTCCTATGAGAACATGCGTTTTCTGATAACTCACAACCCTACCA
ATGCTACTCTCAACAAGTTCACAGAGGAACTTAAGAAGTATGGAGTGACGACTTTGGTTCGAGTTTGTGA
TGCTACATATGATAAAGCTCCAGTTGAAAAAGAAGGAATCCACGTTCTAGATTGGCCATTTGATGATGGA
GCTCCACCCCCTAATCAGATAGTAGATGATTGGTTAAACCTGTTAAAAACCAAATTTCGTGAAGAGCCAG
GTTGCTGTGTTGCAGTGCATTGTGTTGCAGGATTGGGAAGGGCACCTGTGCTGGTTGCACTTGCTTTGAT
TGAATGTGGAATGAAGTACGAAGATGCAGTTCAGTTTATAAGACAAAAAAGAAGGGGAGCGTTCAATTCC
AAACAGCTGCTTTATTTGGAGAAATACCGACCTAAGATGCGATTACGCTTCAGAGATACCAATGGGCATT
GCTGTGTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209983 protein sequence
Red=Cloning site Green=Tags(s)

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNS
KQLLYLEKYRPKMRLRFRDTNGHCCVQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_080391
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080391.4
RefSeq Size 3939 bp
RefSeq ORF 504 bp
Locus ID 8073
UniProt ID Q12974
Cytogenetics 1p35.2
Domains PTPc_motif, Y_phosphatase
Protein Families Druggable Genome, Phosphatase
MW 19.1 kDa
Summary The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010]
Write Your Own Review
You're reviewing:PTP4A2 (NM_080391) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209983L1 Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209983L2 Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC209983L3 Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209983L4 Lenti ORF clone of Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG209983 PTP4A2 (tGFP-tagged) - Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC109921 PTP4A2 (untagged)-Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.