67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone

SKU
RC209795
RPSA (Myc-DDK-tagged)-Human ribosomal protein SA (RPSA), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol 67kDa Laminin Receptor
Synonyms 37LRP; 67LR; ICAS; LAMBR; lamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; NEM/1CHD4; p40; SA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209795 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGAGCCCTTGATGTCCTGCAAATGAAGGAGGAGGATGTCCTTAAGTTCCTTGCAGCAGGAACCC
ACTTAGGTGGCACCAATCTTGACTTCCAGATGGAACAGTACATCTATAAAAGGAAAAGTGATGGCATCTA
TATCATAAATCTCAAGAGGACCTGGGAGAAGCTTCTGCTGGCAGCTCGTGCAATTGTTGCCATTGAAAAC
CCTGCTGATGTCAGTGTTATATCCTCCAGGAATACTGGCCAGAGGGCTGTGCTGAAGTTTGCTGCTGCCA
CTGGAGCCACTCCAATTGCTGGCCGCTTCACTCCTGGAACCTTCACTAACCAGATCCAGGCAGCCTTCCG
GGAGCCACGGCTTCTTGTGGTTACTGACCCCAGGGCTGACCACCAGCCTCTCACGGAGGCATCTTATGTT
AACCTACCTACCATTGCGCTGTGTAACACAGATTCTCCTCTGCGCTATGTGGACATTGCCATCCCATGCA
ACAACAAGGGAGCTCACTCAGTGGGTTTGATGTGGTGGATGCTGGCTCGGGAAGTTCTGCGCATGCGTGG
CACCATTTCCCGTGAACACCCATGGGAGGTCATGCCTGATCTGTACTTCTACAGAGATCCTGAAGAGATT
GAAAAAGAAGGGCAGGCTGCTGCTGAGAAGGCAGTGACCAAGGAGGAATTTCAGGGTGAATGGACTGCTC
CCGCTCCTGAGTTCACTGCTACTCAGCCTGAGGTTGCAGACTGGTCTGAAGGTGTACAGGTGCCCTCTGT
GCCTATTCAGCAATTCCCTACTGAAGACTGGAGCGCTCAGCCTGCCACGGAAGACTGGTCTGCAGCTCCC
ACTGCTCAGGCCACTGAATGGGTAGGAGCAACCACTGACTGGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209795 protein sequence
Red=Cloning site Green=Tags(s)

MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN
PADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV
NLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI
EKEGQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP
TAQATEWVGATTDWS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002295
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002295.6
RefSeq Size 1155 bp
RefSeq ORF 888 bp
Locus ID 3921
UniProt ID P08865
Cytogenetics 3p22.1
Domains Ribosomal_S2
Protein Families Druggable Genome
Protein Pathways Ribosome
MW 32.8 kDa
Summary Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:67kDa Laminin Receptor (RPSA) (NM_002295) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209795L1 Lenti ORF clone of Human ribosomal protein SA (RPSA), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209795L2 Lenti ORF clone of Human ribosomal protein SA (RPSA), transcript variant 1, mGFP tagged 10 ug
$600.00
RC209795L3 Lenti ORF clone of Human ribosomal protein SA (RPSA), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC209795L4 Lenti ORF clone of Human ribosomal protein SA (RPSA), transcript variant 1, mGFP tagged 10 ug
$600.00
RG209795 RPSA (tGFP-tagged) - Human ribosomal protein SA (RPSA), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320110 RPSA (untagged)-Human ribosomal protein SA (RPSA), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.