Activator of basal transcription 1 (ABT1) (NM_013375) Human Tagged ORF Clone

SKU
RC209762
ABT1 (Myc-DDK-tagged)-Human activator of basal transcription 1 (ABT1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Activator of basal transcription 1
Synonyms Esf2; hABT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209762 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCAGAGGAATCGGAGAAGGCCGCAACGGAGCAAGAGCCGCTGGAAGGGACAGAACAGACACTAG
ATGCGGAGGAGGAGCAGGAGGAATCCGAAGAAGCGGCCTGTGGCAGCAAGAAACGGGTAGTGCCAGGTAT
TGTGTACCTGGGCCATATCCCGCCGCGCTTCCGGCCCCTGCACGTCCGCAACCTTCTCAGCGCCTATGGC
GAGGTCGGACGCGTCTTCTTTCAGGCTGAGGACCGGTTCGTGAGACGCAAGAAGAAGGCAGCAGCAGCTG
CCGGAGGAAAAAAGCGGTCCTACACCAAGGACTACACCGAGGGATGGGTGGAGTTCCGTGACAAGCGCAT
AGCCAAGCGCGTGGCGGCCAGTCTACACAACACGCCTATGGGTGCCCGCAGGCGCAGCCCCTTCCGTTAT
GATCTTTGGAACCTCAAGTACTTGCACCGTTTCACCTGGTCCCACCTCAGCGAGCACCTCGCCTTTGAGC
GCCAGGTGCGCAGGCAGCGCTTGAGAGCGGAGGTTGCTCAAGCCAAGCGTGAGACCGACTTCTATCTTCA
AAGTGTGGAACGGGGACAACGCTTTCTTGCGGCCGATGGGGACCCTGCTCGCCCAGATGGCTCCTGGACA
TTTGCCCAGCGTCCTACTGAGCAGGAACTGAGGGCCCGTAAAGCAGCACGGCCAGGGGGACGTGAACGGG
CTCGCCTGGCAACTGCCCAGGACAAGGCCCGCTCCAACAAAGGACTCCTGGCCAGGATCTTTGGAGCCCC
GCCACCCTCAGAGAGCATGGAGGGACCTTCCCTTGTCAGGGACTCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209762 protein sequence
Red=Cloning site Green=Tags(s)

MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYG
EVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRY
DLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWT
FAQRPTEQELRARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_013375
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013375.4
RefSeq Size 2264 bp
RefSeq ORF 819 bp
Locus ID 29777
UniProt ID Q9ULW3
Cytogenetics 6p22.2
Protein Families Transcription Factors
MW 31.1 kDa
Summary Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Activator of basal transcription 1 (ABT1) (NM_013375) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209762L3 Lenti ORF clone of Human activator of basal transcription 1 (ABT1), Myc-DDK-tagged 10 ug
$600.00
RC209762L4 Lenti ORF clone of Human activator of basal transcription 1 (ABT1), mGFP tagged 10 ug
$600.00
RG209762 ABT1 (tGFP-tagged) - Human activator of basal transcription 1 (ABT1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC126249 ABT1 (untagged)-Human activator of basal transcription 1 (ABT1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.