Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

SKU TA330622

Rabbit Polyclonal Anti-ABT1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1. Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: activator of basal transcription 1
• Database Link:
  NP_037507
  Q9ULW3
• Background: Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
• Synonyms: hABT1
• Note: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors