NT2NL (NOTCH2NL) (NM_203458) Human Tagged ORF Clone

SKU
RC209415
NOTCH2NL (Myc-DDK-tagged)-Human notch 2 N-terminal like (NOTCH2NL)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NT2NL
Synonyms N2N; NOTCH2NL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209415 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGTTACCTACCACAATGGCACAGGATACTGCAAATGTCCAGAAGGCTTCTTGGGGGAATATTGTC
AACATCGAGACCCCTGTGAGAAGAACCGCTGCCAGAATGGTGGGACTTGTGTGGCCCAGGCCATGCTGGG
GAAAGCCACGTGCCGATGTGCCTCAGGGTTTACAGGAGAGGACTGCCAGTACTCGACATCTCATCCATGC
TTTGTGTCTCGACCTTGCCTGAATGGCGGCACATGCCATATGCTCAGCCGGGATACCTATGAGTGCACCT
GTCAGGTCGGGTTTACAGGTAAGGAGTGCCAATGGACCGATGCCTGCCTGTCTCATCCCTGTGCAAATGG
AAGTACCTGTACCACTGTGGCCAACCAGTTCTCCTGCAAATGCCTCACAGGCTTCACAGGGCAGAAGTGT
GAGACTGATGTCAATGAGTGTGACATTCCAGGACACTGCCAGCATGGTGGCATCTGCCTCAACCTGCCTG
GTTCCTACCAGTGCCAGTGCCTTCAGGGCTTCACAGGCCAGTACTGTGACAGCCTGTATGTGCCCTGTGC
ACCCTCGCCTTGTGTCAATGGAGGCACCTGTCGGCAGACTGGTGACTTCACTTTTGAGTGCAACTGCCTT
CCAGAAACAGTGAGAAGAGGAACAGAGCTCTGGGAAAGAGACAGGGAAGTCTGGAATGGAAAAGAACACG
ATGAGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209415 protein sequence
Red=Cloning site Green=Tags(s)

MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPC
FVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKC
ETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCL
PETVRRGTELWERDREVWNGKEHDEN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_203458
ORF Size 708 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 5324 bp
RefSeq ORF 711 bp
Locus ID 388677
UniProt ID Q7Z3S9
Cytogenetics 1q21.1
MW 25.8 kDa
Summary Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway (PubMed:29856954, PubMed:29856955, PubMed:29561261). Able to promote neural progenitor self-renewal, possibly by down-regulating neuronal differentiation genes, thereby delaying the differentiation of neuronal progenitors and leading to an overall final increase in neuronal production (PubMed:29856954). Acts by enhancing the Notch signaling pathway via two different mechanisms that probably work in parallel to reach the same effect (PubMed:29856954). Enhances Notch signaling pathway in a non-cell-autonomous manner via direct interaction with NOTCH2 (PubMed:29856954). Also promotes Notch signaling pathway in a cell-autonomous manner through inhibition of cis DLL1-NOTCH2 interactions, which promotes neuronal differentiation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NT2NL (NOTCH2NL) (NM_203458) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209415L1 Lenti ORF clone of Human notch 2 N-terminal like (NOTCH2NL), Myc-DDK-tagged 10 ug
$600.00
RC209415L2 Lenti ORF clone of Human notch 2 N-terminal like (NOTCH2NL), mGFP tagged 10 ug
$600.00
RC209415L3 Lenti ORF clone of Human notch 2 N-terminal like (NOTCH2NL), Myc-DDK-tagged 10 ug
$600.00
RC209415L4 Lenti ORF clone of Human notch 2 N-terminal like (NOTCH2NL), mGFP tagged 10 ug
$600.00
RG209415 NOTCH2NL (tGFP-tagged) - Human notch 2 N-terminal like (NOTCH2NL) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC308192 NOTCH2NL (untagged)-Human notch 2 N-terminal like (NOTCH2NL) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.