C20orf70 (BPIFA2) (NM_080574) Human Tagged ORF Clone

SKU
RC209376
BPIFA2 (Myc-DDK-tagged)-Human chromosome 20 open reading frame 70 (C20orf70)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C20orf70
Synonyms bA49G10.1; C20orf70; PSP; SPLUNC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209376 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTCAGCTTTGGAAACTTGTTCTCCTGTGCGGCGTGCTCACTGGGACCTCAGAGTCTCTTCTTGACA
ATCTTGGCAATGACCTAAGCAATGTCGTGGATAAGCTGGAACCTGTTCTTCACGAGGGACTTGAGACAGT
TGACAATACTCTTAAAGGCATCCTTGAGAAACTGAAGGTCGACCTAGGAGTGCTTCAGAAATCCAGTGCT
TGGCAACTGGCCAAGCAGAAGGCCCAGGAAGCTGAGAAATTGCTGAACAATGTCATTTCTAAGCTGCTTC
CAACTAACACGGACATTTTTGGGTTGAAAATCAGCAACTCCCTCATCCTGGATGTCAAAGCTGAACCGAT
CGATGATGGCAAAGGCCTTAACCTGAGCTTCCCTGTCACCGCGAATGTCACTGTGGCCGGGCCCATCATT
GGCCAGATTATCAACCTGAAAGCCTCCTTGGACCTCCTGACCGCAGTCACAATTGAAACTGATCCCCAGA
CACACCAGCCTGTTGCCGTCCTGGGAGAATGCGCCAGTGACCCAACCAGCATCTCACTTTCCTTGCTGGA
CAAACACAGCCAAATCATCAACAAGTTCGTGAATAGCGTGATCAACACGCTGAAAAGCACTGTATCCTCC
CTGCTGCAGAAGGAGATATGTCCACTGATCCGCATCTTCATCCACTCCCTGGATGTGAATGTCATTCAGC
AGGTCGTCGATAATCCTCAGCACAAAACCCAGCTGCAAACCCTCATC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209376 protein sequence
Red=Cloning site Green=Tags(s)

MLQLWKLVLLCGVLTGTSESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSA
WQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPII
GQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSS
LLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_080574
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080574.4
RefSeq Size 1054 bp
RefSeq ORF 750 bp
Locus ID 140683
UniProt ID Q96DR5
Cytogenetics 20q11.21
Protein Families Secreted Protein
MW 27 kDa
Summary This gene encodes a member of the palate, lung and nasal epithelium clone (Plunc) family of proteins. Members of this family have been proposed to play a role in the local antibacterial response in nose, mouth and upper respiratory pathways. The encoded soluble salivary protein binds bacterial lipopolysaccharide (LPS) and inhibits bacterial growth. This gene is present in a gene cluster on chromosome 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:C20orf70 (BPIFA2) (NM_080574) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209376L1 Lenti ORF clone of Human chromosome 20 open reading frame 70 (C20orf70), Myc-DDK-tagged 10 ug
$600.00
RC209376L2 Lenti ORF clone of Human chromosome 20 open reading frame 70 (C20orf70), mGFP tagged 10 ug
$600.00
RC209376L3 Lenti ORF clone of Human chromosome 20 open reading frame 70 (C20orf70), Myc-DDK-tagged 10 ug
$600.00
RC209376L4 Lenti ORF clone of Human chromosome 20 open reading frame 70 (C20orf70), mGFP tagged 10 ug
$600.00
RG209376 BPIFA2 (tGFP-tagged) - Human chromosome 20 open reading frame 70 (C20orf70) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC305797 BPIFA2 (untagged)-Human chromosome 20 open reading frame 70 (C20orf70) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.