PPM1D (NM_003620) Human Tagged ORF Clone

CAT#: RC209328

Reviews ()
Write a review

PPM1D (Myc-DDK-tagged)-Human protein phosphatase, Mg2+/Mn2+ dependent, 1D (PPM1D)



  "NM_003620" in other vectors (6)

USD 640.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PPM1D (NM_003620) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPM1D
Synonyms IDDGIP; PP2C-DELTA; WIP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC209328 representing NM_003620
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGACG
TTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCGGTCGCTGTCTCA
GCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGTCTCGGGGAAAGGCCCAGCGGTG
GCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGCTGCTGCCGCC
GCCGTTCCTCCGTGGCCTTTTTCGCCGTGTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCG
GGAGCACTTGTGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCT
GCCATCCGCAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGACTA
TGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCATGAAGATGTATGT
AGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCT
GTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAAGGAAAGAGAACGAATCGAAGGACTTGGTGGGA
GTGTAATGAACAAGTCTGGGGTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGT
TAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGGTGATTTGTGGAGC
TATGATTTCTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACTCTTGACCCTC
AGAAGCACAAGTATATTATATTGGGGAGTGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTC
AATGTGCCAGGACCAAGAGGAGAAAAAATACCTGATGGGTGAGCATGGACAATCTTGTGCCAAAATGCTT
GTGAATCGAGCATTGGGCCGCTGGAGGCAGCGTATGCTCCGAGCAGATAACACTAGTGCCATAGTAATCT
GCATCTCTCCAGAAGTGGACAATCAGGGAAACTTTACCAATGAAGATGAGTTATACCTGAACCTGACTGA
CAGCCCTTCCTATAATAGTCAAGAAACCTGTGTGATGACTCCTTCCCCATGTTCTACACCACCAGTCAAG
TCACTGGAGGAGGATCCATGGCCAAGGGTGAATTCTAAGGACCATATACCTGCCCTGGTTCGTAGCAATG
CCTTCTCAGAGAATTTTTTAGAGGTTTCAGCTGAGATAGCTCGAGAGAATGTCCAAGGTGTAGTCATACC
CTCAAAAGATCCAGAACCACTTGAAGAAAATTGCGCTAAAGCCCTGACTTTAAGGATACATGATTCTTTG
AATAATAGCCTTCCAATTGGCCTTGTGCCTACTAATTCAACAAACACTGTCATGGACCAAAAAAATTTGA
AGATGTCAACTCCTGGCCAAATGAAAGCCCAAGAAATTGAAAGAACCCCTCCAACAAACTTTAAAAGGAC
ATTAGAAGAGTCCAATTCTGGCCCCCTGATGAAGAAGCATAGACGAAATGGCTTAAGTCGAAGTAGTGGT
GCTCAGCCTGCAAGTCTCCCCACAACCTCACAGCGAAAGAACTCTGTTAAACTCACCATGCGACGCAGAC
TTAGGGGCCAGAAGAAAATTGGAAATCCTTTACTTCATCAACACAGGAAAACTGTTTGTGTTTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209328 representing NM_003620
Red=Cloning site Green=Tags(s)

MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAV
AAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCA
AIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRA
VEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWS
YDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKML
VNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAKALTLRIHDSL
NNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEESNSGPLMKKHRRNGLSRSSG
AQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRKTVCVC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003620
ORF Size 1815 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003620.1, NM_003620.2, NM_003620.3, NP_003611.1
RefSeq Size 3163 bp
RefSeq ORF 1818 bp
Locus ID 8493
Cytogenetics 17q23.2
Domains PP2C
Protein Families Druggable Genome, Phosphatase
Protein Pathways p53 signaling pathway
MW 66.5 kDa
Gene Summary The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PPM1D"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


PPM1D mouse monoclonal antibody,clone OTI3A7
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools