STX1B (NM_052874) Human Tagged ORF Clone

SKU
RC209124
STX1B (Myc-DDK-tagged)-Human syntaxin 1B (STX1B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol STX1B
Synonyms GEFSP9; STX1B1; STX1B2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209124 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGATCGGACTCAAGAGCTGCGGAGTGCGAAAGACAGTGATGATGAAGAGGAGGTGGTCCACGTGG
ATCGGGACCACTTCATGGATGAGTTCTTTGAACAGGTGGAAGAGATCCGGGGCTGCATTGAGAAACTGTC
GGAGGATGTGGAGCAGGTGAAAAAACAGCATAGCGCCATCCTGGCCGCACCCAACCCAGATGAGAAGACC
AAACAGGAGCTGGAGGATCTCACTGCAGACATCAAGAAGACGGCCAACAAGGTTCGGTCCAAATTGAAAG
CGATCGAGCAAAGCATTGAACAGGAGGAGGGGCTGAACCGTTCCTCCGCGGACCTGCGCATCCGCAAGAC
CCAGCACTCCACACTGTCCCGGAAGTTCGTGGAGGTAATGACCGAATATAACGCGACCCAGTCCAAGTAC
CGGGACCGCTGCAAGGACCGGATCCAGCGGCAACTGGAGATCACTGGAAGGACCACCACCAACGAAGAAC
TGGAAGACATGCTGGAGAGCGGGAAGCTGGCCATCTTCACAGATGACATCAAAATGGACTCACAGATGAC
GAAGCAGGCGCTGAATGAGATTGAGACGAGGCACAATGAGATCATCAAGCTGGAGACCAGCATCCGCGAG
CTGCACGATATGTTTGTGGACATGGCCATGCTCGTAGAGAGCCAGGGAGAGATGATTGACCGCATCGAGT
ACAACGTGGAACATTCTGTGGACTACGTGGAGCGAGCTGTGTCTGACACCAAGAAAGCAGTGAAATATCA
GAGCAAGGCCCGGAGGAAGAAAATCATGATCATCATTTGCTGTGTGGTGCTGGGGGTGGTCTTGGCGTCG
TCCATTGGGGGGACGCTGGGCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209124 protein sequence
Red=Cloning site Green=Tags(s)

MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKT
KQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKY
RDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRE
LHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLAS
SIGGTLGL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_052874
ORF Size 864 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_052874.5
RefSeq Size 4544 bp
RefSeq ORF 867 bp
Locus ID 112755
UniProt ID P61266
Cytogenetics 16p11.2
Domains SynN, t_SNARE
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 33.2 kDa
Summary The protein encoded by this gene belongs to a family of proteins thought to play a role in the exocytosis of synaptic vesicles. Vesicle exocytosis releases vesicular contents and is important to various cellular functions. For instance, the secretion of transmitters from neurons plays an important role in synaptic transmission. After exocytosis, the membrane and proteins from the vesicle are retrieved from the plasma membrane through the process of endocytosis. Mutations in this gene have been identified as one cause of fever-associated epilepsy syndromes. A possible link between this gene and Parkinson's disease has also been suggested. [provided by RefSeq, Jan 2015]
Write Your Own Review
You're reviewing:STX1B (NM_052874) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209124L3 Lenti ORF clone of Human syntaxin 1B (STX1B), Myc-DDK-tagged 10 ug
$600.00
RC209124L4 Lenti ORF clone of Human syntaxin 1B (STX1B), mGFP tagged 10 ug
$600.00
RG209124 STX1B (tGFP-tagged) - Human syntaxin 1B (STX1B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC120156 STX1B (untagged)-Human syntaxin 1B (STX1B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.