NOP10 (NM_018648) Human Tagged ORF Clone
SKU
RC209038
NOP10 (Myc-DDK-tagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | NOP10 |
Synonyms | DKCB1; NOLA3; NOP10P |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC209038 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTCTCCAGTATTACCTCAACGAGCAGGGAGATCGAGTCTATACGCTGAAGAAATTTGACCCGATGG GACAACAGACCTGCTCAGCCCATCCTGCTCGGTTCTCCCCAGATGACAAATACTCTCGACACCGAATCAC CATCAAGAAACGCTTCAAGGTGCTCATGACCCAGCAACCGCGCCCTGTCCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209038 protein sequence
Red=Cloning site Green=Tags(s) MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_018648 |
ORF Size | 192 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_018648.4 |
RefSeq Size | 552 bp |
RefSeq ORF | 195 bp |
Locus ID | 55505 |
UniProt ID | Q9NPE3 |
Cytogenetics | 15q14 |
MW | 7.7 kDa |
Summary | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC209038L3 | Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC209038L4 | Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), mGFP tagged | 10 ug |
$450.00
|
|
RG209038 | NOP10 (tGFP-tagged) - Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) | 10 ug |
$489.00
|
|
SC113406 | NOP10 (untagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.