NOP10 (NM_018648) Human Tagged ORF Clone

SKU
RG209038
NOP10 (tGFP-tagged) - Human NOP10 ribonucleoprotein homolog (yeast) (NOP10)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NOP10
Synonyms DKCB1; NOLA3; NOP10P
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG209038 representing NM_018648
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCTCCAGTATTACCTCAACGAGCAGGGAGATCGAGTCTATACGCTGAAGAAATTTGACCCGATGG
GACAACAGACCTGCTCAGCCCATCCTGCTCGGTTCTCCCCAGATGACAAATACTCTCGACACCGAATCAC
CATCAAGAAACGCTTCAAGGTGCTCATGACCCAGCAACCGCGCCCTGTCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG209038 representing NM_018648
Red=Cloning site Green=Tags(s)

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018648
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018648.4
RefSeq Size 556 bp
RefSeq ORF 195 bp
Locus ID 55505
UniProt ID Q9NPE3
Cytogenetics 15q14
Summary This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:NOP10 (NM_018648) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209038 NOP10 (Myc-DDK-tagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) 10 ug
$150.00
RC209038L3 Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), Myc-DDK-tagged 10 ug
$450.00
RC209038L4 Lenti ORF clone of Human NOP10 ribonucleoprotein homolog (yeast) (NOP10), mGFP tagged 10 ug
$450.00
SC113406 NOP10 (untagged)-Human NOP10 ribonucleoprotein homolog (yeast) (NOP10) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.