C15orf38 (ARPIN) (NM_182616) Human Tagged ORF Clone

SKU
RC208793
C15orf38 (Myc-DDK-tagged)-Human chromosome 15 open reading frame 38 (C15orf38)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C15orf38
Synonyms C15orf38
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208793 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCGCATCTACCACGACGGCGCGCTCCGGAACAAGGCGGTGCAGAGCGTCCGGCTGCCAGGGGCCT
GGGACCCCGCCGCCCACCAGGGGGGAAATGGTGTCCTGCTGGAGGGAGAACTGATCGATGTATCTCGGCA
CAGCATCTTGGACACTCATGGCAGGAAGGAGCGCTACTACGTGCTGTATATCCGGCCCAGTCACATCCAT
CGCCGTAAATTCGACGCCAAGGGAAATGAAATCGAGCCCAACTTCAGCGCCACCAGGAAGGTGAACACGG
GCTTCCTCATGTCGTCCTACAAGGTGGAAGCCAAGGGGGACACTGACAGGCTCACGCCCGAGGCGCTGAA
GGGGCTGGTCAACAAGCCAGAGCTGCTCGCGCTGACAGAGAGCCTCACCCCCGACCACACAGTGGCGTTC
TGGATGCCCGAGTCAGAGATGGAGGTGATGGAACTCGAGCTGGGGGCCGGGGTACGGCTGAAGACTCGGG
GCGATGGTCCCTTCCTGGATTCATTGGCCAAACTTGAGGCTGGAACAGTGACCAAGTGTAATTTCACTGG
TGATGGAAAGACAGGGGCATCCTGGACAGACAACATCATGGCCCAAAAGTGTTCGAAGGGGGCTGCAGCG
GAGATCCGAGAGCAGGGGGATGGGGCAGAGGACGAGGAGTGGGATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208793 protein sequence
Red=Cloning site Green=Tags(s)

MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH
RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF
WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA
EIREQGDGAEDEEWDD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_182616
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_182616.4
RefSeq Size 6114 bp
RefSeq ORF 681 bp
Locus ID 348110
UniProt ID Q7Z6K5
Cytogenetics 15q26.1
MW 24.9 kDa
Summary Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C15orf38 (ARPIN) (NM_182616) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208793L3 Lenti ORF clone of Human chromosome 15 open reading frame 38 (C15orf38), Myc-DDK-tagged 10 ug
$600.00
RC208793L4 Lenti ORF clone of Human chromosome 15 open reading frame 38 (C15orf38), mGFP tagged 10 ug
$600.00
RG208793 C15orf38 (tGFP-tagged) - Human chromosome 15 open reading frame 38 (C15orf38) 10 ug
$500.00
SC321902 C15orf38 (untagged)-Human chromosome 15 open reading frame 38 (C15orf38) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.