PCGF5 (NM_032373) Human Tagged ORF Clone

SKU
RC208679
PCGF5 (Myc-DDK-tagged)-Human polycomb group ring finger 5 (PCGF5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PCGF5
Synonyms RNF159
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208679 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACCCAAAGGAAACACTTGGTGAAAGATTTTAATCCTTACATTACCTGCTATATCTGTAAAGGGT
ATCTGATCAAGCCAACAACAGTGACGGAATGCCTCCATACATTCTGTAAGACTTGTATTGTTCAGCACTT
TGAAGATAGCAATGATTGCCCAAGGTGTGGCAACCAAGTTCATGAGACAAATCCATTAGAAATGTTGAGG
TTGGACAATACATTAGAGGAAATTATATTTAAGCTGGTCCCTGGACTACGAGAACAAGAACTTGAGCGTG
AATCTGAATTTTGGAAGAAAAATAAGCCTCAAGAAAATGGACAAGATGATACTTCAAAAGCTGACAAACC
GAAAGTAGATGAAGAAGGTGATGAAAATGAAGATGATAAAGATTATCACAGAAGTGACCCACAAATTGCT
ATCTGTCTAGATTGTTTACGAAATAATGGGCAATCAGGGGACAATGTAGTAAAGGGTTTAATGAAGAAAT
TCATTCGATGTTCTACACGTGTAACTGTGGGAACTATTAAAAAATTTCTAAGTTTAAAACTAAAACTTCC
AAGTTCTTATGAGTTGGATGTGCTGTGCAATGGTGAAATTATGGGGAAGGATCATACTATGGAATTCATC
TACATGACAAGATGGCGACTAAGAGGCGAAAACTTTCGGTGTCTGAACTGCTCAGCTTCGCAAGTCTGCT
CTCAGGATGGCCCTTTGTATCAGTCATACCCTATGGTACTGCAGTATCGACCAAGAATTGATTTCGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208679 protein sequence
Red=Cloning site Green=Tags(s)

MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLR
LDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIA
ICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFI
YMTRWRLRGENFRCLNCSASQVCSQDGPLYQSYPMVLQYRPRIDFG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032373
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032373.5
RefSeq Size 7222 bp
RefSeq ORF 771 bp
Locus ID 84333
UniProt ID Q86SE9
Cytogenetics 10q23.32
MW 29.7 kDa
Summary Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:26151332). Within the PRC1-like complex, regulates RNF2 ubiquitin ligase activity (PubMed:26151332). Plays a redundant role with PCGF3 as part of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PCGF5 (NM_032373) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208679L1 Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), Myc-DDK-tagged 10 ug
$600.00
RC208679L2 Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), mGFP tagged 10 ug
$600.00
RC208679L3 Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), Myc-DDK-tagged 10 ug
$600.00
RC208679L4 Lenti ORF clone of Human polycomb group ring finger 5 (PCGF5), mGFP tagged 10 ug
$600.00
RG208679 PCGF5 (tGFP-tagged) - Human polycomb group ring finger 5 (PCGF5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC105003 PCGF5 (untagged)-Human polycomb group ring finger 5 (PCGF5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.