CD53 (NM_000560) Human Tagged ORF Clone

SKU
RC208095
CD53 (Myc-DDK-tagged)-Human CD53 molecule (CD53), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD53
Synonyms MOX44; TSPAN25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208095 representing NM_000560
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATGAGTAGCTTGAAACTGCTGAAGTATGTCCTGTTTTTCTTCAACTTGCTCTTTTGGATCTGTG
GCTGCTGCATTTTGGGCTTTGGGATCTACCTGCTGATCCACAACAACTTCGGAGTGCTCTTCCATAACCT
CCCCTCCCTCACGCTGGGCAATGTGTTTGTCATCGTGGGCTCTATTATCATGGTAGTTGCCTTCCTGGGC
TGCATGGGCTCTATCAAGGAAAACAAGTGTCTGCTTATGTCGTTCTTCATCCTGCTGCTGATTATCCTCC
TTGCTGAGGTGACCTTGGCCATCCTGCTCTTTGTATATGAACAGAAGCTGAATGAGTATGTGGCTAAGGG
TCTGACCGACAGCATCCACCGTTACCACTCAGACAATAGCACCAAGGCAGCGTGGGACTCCATCCAGTCA
TTTCTGCAGTGTTGTGGTATAAATGGCACGAGTGATTGGACCAGTGGCCCACCAGCATCTTGCCCCTCAG
ATCGAAAAGTGGAGGGTTGCTATGCGAAAGCAAGACTGTGGTTTCATTCCAATTTCCTGTATATCGGAAT
CATCACCATCTGTGTATGTGTGATTGAGGTGTTGGGGATGTCCTTTGCACTGACCCTGAACTGCCAGATT
GACAAAACCAGCCAGACCATAGGGCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208095 representing NM_000560
Red=Cloning site Green=Tags(s)

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLG
CMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQS
FLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI
DKTSQTIGL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000560
ORF Size 657 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000560.4
RefSeq Size 1567 bp
RefSeq ORF 660 bp
Locus ID 963
UniProt ID P19397
Cytogenetics 1p13.3
Domains transmembrane4
Protein Families Transmembrane
MW 24.2 kDa
Summary The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Write Your Own Review
You're reviewing:CD53 (NM_000560) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208095L3 Lenti ORF clone of Human CD53 molecule (CD53), transcript variant 2, Myc-DDK-tagged 10 ug
$750.00
RC208095L4 Lenti ORF clone of Human CD53 molecule (CD53), transcript variant 2, mGFP tagged 10 ug
$750.00
RG208095 CD53 (tGFP-tagged) - Human CD53 molecule (CD53), transcript variant 2 10 ug
$650.00
SC119837 CD53 (untagged)-Human CD53 molecule (CD53), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.