DDX26 (INTS6) (NM_012141) Human Tagged ORF Clone

CAT#: RC208036

Reviews ()
Write a review

INTS6 (Myc-DDK-tagged)-Human integrator complex subunit 6 (INTS6), transcript variant 1



  "NM_012141" in other vectors (5)

Reconstitution Protocol

USD 812.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "INTS6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol INTS6
Synonyms DBI-1; DDX26; DDX26A; DICE1; HDB; INT6; Notchl2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208036 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCATCTTACTGTTCCTGATAGACACGTCTGCCTCTATGAACCAGCGCAGCCATCTGGGCACCACCT
ACCTGGACACGGCCAAAGGCGCGGTAGAGACCTTCATGAAGCTCCGTGCCCGGGACCCTGCCAGCAGAGG
AGACAGGTATATGCTGGTCACTTTCGAAGAGCCGCCCTATGCTATCAAGGCTGGATGGAAAGAAAACCAT
GCAACGTTTATGAATGAATTGAAAAACCTTCAGGCTGAAGGACTTACGACTCTTGGCCAATCCCTAAGGA
CAGCTTTTGATTTATTAAATTTAAATAGATTAGTAACTGGCATAGACAACTATGGGCAGGGAAGAAACCC
TTTTTTCTTGGAGCCAGCAATAATTATCACAATTACTGATGGGAGCAAGTTGACTACCACCAGTGGAGTC
CAGGATGAGCTTCATTTACCTCTTAATTCTCCTTTGCCTGGAAGTGAATTGACCAAGGAACCTTTTCGTT
GGGATCAGAGACTCTTTGCATTAGTGTTGCGGTTGCCTGGCACCATGTCAGTAGAATCAGAACAGTTGAC
AGGTGTGCCTTTAGATGACTCTGCAATCACACCAATGTGTGAAGTGACAGGCGGCCGTTCATATTCTGTG
TGTTCTCCAAGAATGCTTAATCAGTGTCTGGAGTCCTTGGTGCAGAAAGTACAAAGTGGGGTGGTAATAA
ACTTTGAAAAAGCAGGACCAGATCCTTCCCCTGTAGAAGATGGGCAGCCAGATATATCAAGGCCTTTTGG
ATCTCAGCCTTGGCATAGCTGTCACAAACTCATATATGTCAGACCAAATCCTAAAACTGGGGTTCCTATA
GGTCATTGGCCTGTTCCAGAGTCTTTTTGGCCAGATCAAAATTCGCCAACACTACCACCTCGTACATCTC
ATCCTGTAGTGAAGTTTTCCTGTACAGACTGTGAACCAATGGTTATTGATAAACTTCCTTTTGACAAATA
TGAGTTGGAACCTTCACCACTGACTCAATTTATCCTGGAAAGGAAATCTCCTCAAACATGTTGGCAGGTG
TACGTGAGCAATAGTGCAAAATACAGTGAACTTGGTCATCCTTTTGGTTACTTGAAAGCCAGTACAGCAC
TGAACTGTGTCAACTTATTTGTGATGCCTTACAATTATCCAGTCCTTCTTCCCCTCTTAGATGACTTGTT
TAAAGTGCATAAAGCAAAACCAACATTGAAGTGGAGACAGTCATTTGAAAGTTATTTGAAGACAATGCCT
CCCTACTATCTTGGGCCCTTGAAGAAAGCTGTTAGGATGATGGGAGCACCTAACCTAATAGCAGACAGTA
TGGAATATGGACTTAGTTACAGTGTCATTTCATACCTCAAAAAACTGAGTCAACAGGCCAAAATAGAATC
TGATCGAGTCATTGGATCTGTAGGCAAAAAAGTAGTACAGGAGACTGGAATAAAAGTCCGGAGCCGATCA
CATGGTTTATCAATGGCATATAGGAAAGATTTTCAACAACTCCTCCAGGGAATTTCAGAGGATGTCCCTC
ACAGACTGCTAGACCTTAATATGAAGGAATACACTGGGTTCCAAGTTGCTTTGCTGAATAAGGATTTGAA
GCCACAGACATTTAGAAATGCTTATGACATACCAAGACGAAATCTTTTGGATCACTTAACAAGAATGAGA
TCTAATCTTTTGAAGAGCACTCGCAGATTTCTGAAAGGACAGGACGAAGATCAAGTGCACAGTGTTCCTA
TAGCACAAATGGGGAACTACCAGGAATACCTCAAGCAAGTACCTTCTCCACTAAGAGAACTTGATCCTGA
TCAGCCACGAAGGTTGCATACATTTGGCAACCCCTTTAAGCTGGATAAGAAGGGTATGATGATAGATGAA
GCAGATGAATTTGTGGCTGGACCTCAAAATAAACATAAACGACCCGGAGAACCAAATATGCAAGGGATCC
CTAAAAGACGTCGGTGTATGTCTCCACTACTAAGAGGCAGACAGCAGAATCCTGTTGTAAACAATCATAT
TGGGGGAAAAGGACCACCTGCACCTACAACTCAAGCACAGCCAGATCTTATTAAACCTCTTCCTCTTCAT
AAAATTTCAGAAACCACTAATGATTCGATAATACATGATGTGGTTGAAAATCATGTTGCAGACCAACTTT
CATCAGACATTACACCAAATGCTATGGATACGGAATTTTCAGCATCTTCTCCAGCCAGTTTACTGGAACG
GCCAACCAATCATATGGAGGCTCTTGGTCATGACCATTTAGGAACCAATGACCTCACTGTTGGTGGATTT
TTAGAAAATCATGAGGAGCCAAGAGATAAAGAACAATGTGCTGAAGAGAACATACCAGCATCTTCACTCA
ACAAAGGAAAGAAATTGATGCATTGCAGAAGCCATGAAGAGGTCAATACTGAACTAAAAGCACAAATAAT
GAAAGAGATCCGAAAGCCAGGAAGAAAATATGAAAGAATCTTCACTTTACTGAAGCATGTGCAAGGCAGT
TTACAAACAAGACTAATATTTTTACAAAATGTCATTAAAGAAGCATCAAGGTTTAAAAAACGAATGCTAA
TAGAACAACTGGAGAACTTCTTGGATGAAATTCATCGAAGAGCCAATCAGATCAACCATATTAATAGCAA
T


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208036 protein sequence
Red=Cloning site Green=Tags(s)

MPILLFLIDTSASMNQRSHLGTTYLDTAKGAVETFMKLRARDPASRGDRYMLVTFEEPPYAIKAGWKENH
ATFMNELKNLQAEGLTTLGQSLRTAFDLLNLNRLVTGIDNYGQGRNPFFLEPAIIITITDGSKLTTTSGV
QDELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGTMSVESEQLTGVPLDDSAITPMCEVTGGRSYSV
CSPRMLNQCLESLVQKVQSGVVINFEKAGPDPSPVEDGQPDISRPFGSQPWHSCHKLIYVRPNPKTGVPI
GHWPVPESFWPDQNSPTLPPRTSHPVVKFSCTDCEPMVIDKLPFDKYELEPSPLTQFILERKSPQTCWQV
YVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMP
PYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIESDRVIGSVGKKVVQETGIKVRSRS
HGLSMAYRKDFQQLLQGISEDVPHRLLDLNMKEYTGFQVALLNKDLKPQTFRNAYDIPRRNLLDHLTRMR
SNLLKSTRRFLKGQDEDQVHSVPIAQMGNYQEYLKQVPSPLRELDPDQPRRLHTFGNPFKLDKKGMMIDE
ADEFVAGPQNKHKRPGEPNMQGIPKRRRCMSPLLRGRQQNPVVNNHIGGKGPPAPTTQAQPDLIKPLPLH
KISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGF
LENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGS
LQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012141
ORF Size 2661 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012141.3
RefSeq Size 7465 bp
RefSeq ORF 2664 bp
Locus ID 26512
UniProt ID Q9UL03
Cytogenetics 13q14.3
Protein Families Druggable Genome
MW 100.4 kDa
Gene Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2015]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.