DDX26 (INTS6) Rabbit Polyclonal Antibody

SKU TA341582

Rabbit Polyclonal Anti-INTS6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-INTS6 antibody: synthetic peptide directed towards the C terminal of human INTS6. Synthetic peptide located within the following region: GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 99 kDa
• Gene Name: integrator complex subunit 6
• Database Link:
  NP_001035026
  Q9UL03
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.The protein encoded byThis gene is a DEAD box protein that is part of a complex that interacts withThe C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition,This gene is a candidate tumor suppressor and located inThe critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: DBI-1; DDX26; DDX26A; DICE1; HDB; INT6; Notchl2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome