OriGene Logo

DDX26 (INTS6) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341582
Rabbit Polyclonal Anti-INTS6 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415954 Transient overexpression lysate of integrator complex subunit 6 (INTS6), transcript variant 1 100 ug
$436.00

View other "DDX26 or NM_001039937" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-INTS6 antibody: synthetic peptide directed towards the C terminal of human INTS6. Synthetic peptide located within the following region: GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 99 kDa
Gene Name integrator complex subunit 6
Database Link
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.The protein encoded byThis gene is a DEAD box protein that is part of a complex that interacts withThe C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition,This gene is a candidate tumor suppressor and located inThe critical region of loss of heterozygosity (LOH). Three transcript variants encoding two different isoforms have been found forThis gene. provided by RefSeq, Jul 2008
Synonyms DBI-1; DDX26; DDX26A; DICE1; HDB; INT6; Notchl2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.