TAF5L (NM_001025247) Human Tagged ORF Clone

SKU
RC207751
TAF5L (Myc-DDK-tagged)-Human TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF5L), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TAF5L
Synonyms PAF65B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207751 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACGAGTGCGTACCGAGCAGATTCAGATGGCAGTGTCCTGCTACCTCAAACGCCGGCAGTACGTGG
ACTCAGATGGTCCCCTGAAGCAAGGACTGCGGCTGTCACAGACTGCTGAAGAGATGGCGGCCAATCTAAC
AGTGCAATCAGAATCTGGTTGTGCCAACATAGTGTCTGCAGCCCCTTGCCAGGCAGAACCCCAGCAATAT
GAAGTACAGTTTGGACGACTGCGGAATTTTCTCACTGATTCTGATTCCCAGCATAGCCACGAAGTGATGC
CTCTCCTCTATCCTCTCTTTGTCTACCTCCATCTCAACCTGGTCCAAAACAGTCCGAAGAGCACAGTGGA
AAGTTTTTACAGCCGCTTCCATGGAATGTTTCTGCAGAATGCTAGCCAGAAGGATGTCATTGAGCAGCTA
CAGACCACTCAAACCATCCAGGACATCCTATCTAACTTCAAGCTTCGAGCATTCCTAGATAACAAGTACG
TGGTCCGTCTCCAAGAAGACAGCTACAACTACCTTATCCGCTACCTCCAAAGTGACAACAATACTGCCCT
GTGCAAAGTCCTCACCTTACATATTCATCTTGACGTGCAGCCTGCCAAGAGAACAGACTATCAGCTGTAT
GCCAGTGGCAGCTCCTCCCGCAGTGAGAACAACGGTTTGGAGCCCCCTGACATGCCCAGCCCTATTCTGC
AGAACGAGGCTGCCCTAGAGGTCTTACAGGAGAGCATTAAGCGCGTCAAGGATGGGCCTCCCTCCCTCAC
TACCATCTGCTTCTATGCCTTCTATAACACAGAGCAGCTGTTGAACACTGCAGAAATCTCCCCCGATAGC
AAGCTGCTTGCTGCTGGGTTTGACAACTCCTGTATAAAACTTTGGAGTTTACGATCCAAGAAGTTAAAAT
CAGAGCCCCACCAAGTAGACGTGTCCCGCATCCATTTGGCTTGTGATATTCTGGAGGAGGAGGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207751 protein sequence
Red=Cloning site Green=Tags(s)

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQY
EVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQL
QTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLY
ASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDS
KLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001025247
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001025247.1, NP_001020418.1
RefSeq Size 4139 bp
RefSeq ORF 978 bp
Locus ID 27097
UniProt ID O75529
Cytogenetics 1q42.13
Protein Families Transcription Factors
Protein Pathways Basal transcription factors
MW 37 kDa
Summary The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TAF5L (NM_001025247) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207751L3 Lenti ORF clone of Human TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF5L), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC207751L4 Lenti ORF clone of Human TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF5L), transcript variant 2, mGFP tagged 10 ug
$600.00
RG207751 TAF5L (tGFP-tagged) - Human TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF5L), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC302381 TAF5L (untagged)-Human TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa (TAF5L), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.