SFRP1 (NM_003012) Human Tagged ORF Clone

SKU
RC207328
SFRP1 (Myc-DDK-tagged)-Human secreted frizzled-related protein 1 (SFRP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SFRP1
Synonyms FRP; FRP-1; FRP1; FrzA; SARP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207328 representing NM_003012
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATCGGGCGCAGCGAGGGGGGCCGCCGCGGGGCAGCCCTGGGCGTGCTGCTGGCGCTGGGCGCGG
CGCTTCTGGCCGTGGGCTCGGCCAGCGAGTACGACTACGTGAGCTTCCAGTCGGACATCGGCCCGTACCA
GAGCGGGCGCTTCTACACCAAGCCACCTCAGTGCGTGGACATCCCCGCGGACCTGCGGCTGTGCCACAAC
GTGGGCTACAAGAAGATGGTGCTGCCCAACCTGCTGGAGCACGAGACCATGGCGGAGGTGAAGCAGCAGG
CCAGCAGCTGGGTGCCCCTGCTCAACAAGAACTGCCACGCCGGCACCCAGGTCTTCCTCTGCTCGCTCTT
CGCGCCCGTCTGCCTGGACCGGCCCATCTACCCGTGTCGCTGGCTCTGCGAGGCCGTGCGCGACTCGTGC
GAGCCGGTCATGCAGTTCTTCGGCTTCTACTGGCCCGAGATGCTTAAGTGTGACAAGTTCCCCGAGGGGG
ACGTCTGCATCGCCATGACGCCGCCCAATGCCACCGAAGCCTCCAAGCCCCAAGGCACAACGGTGTGTCC
TCCCTGTGACAACGAGTTGAAATCTGAGGCCATCATTGAACATCTCTGTGCCAGCGAGTTTGCACTGAGG
ATGAAAATAAAAGAAGTGAAAAAAGAAAATGGCGACAAGAAGATTGTCCCCAAGAAGAAGAAGCCCCTGA
AGTTGGGGCCCATCAAGAAGAAGGACCTGAAGAAGCTTGTGCTGTACCTGAAGAATGGGGCTGACTGTCC
CTGCCACCAGCTGGACAACCTCAGCCACCACTTCCTCATCATGGGCCGCAAGGTGAAGAGCCAGTACTTG
CTGACGGCCATCCACAAGTGGGACAAGAAAAACAAGGAGTTCAAAAACTTCATGAAGAAAATGAAAAACC
ATGAGTGCCCCACCTTTCAGTCCGTGTTTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207328 representing NM_003012
Red=Cloning site Green=Tags(s)

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003012
ORF Size 942 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003012.5
RefSeq Size 4465 bp
RefSeq ORF 945 bp
Locus ID 6422
UniProt ID Q8N474
Cytogenetics 8p11.21
Domains FRI, NTR
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
Protein Pathways Wnt signaling pathway
MW 35.2 kDa
Summary This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009]
Write Your Own Review
You're reviewing:SFRP1 (NM_003012) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207328L1 Lenti ORF clone of Human secreted frizzled-related protein 1 (SFRP1), Myc-DDK-tagged 10 ug
$600.00
RC207328L2 Lenti ORF clone of Human secreted frizzled-related protein 1 (SFRP1), mGFP tagged 10 ug
$600.00
RC207328L3 Lenti ORF clone of Human secreted frizzled-related protein 1 (SFRP1), Myc-DDK-tagged 10 ug
$600.00
RC207328L4 Lenti ORF clone of Human secreted frizzled-related protein 1 (SFRP1), mGFP tagged 10 ug
$600.00
RG207328 SFRP1 (tGFP-tagged) - Human secreted frizzled-related protein 1 (SFRP1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118246 SFRP1 (untagged)-Human secreted frizzled-related protein 1 (SFRP1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.