Alpha SNAP (NAPA) (NM_003827) Human Tagged ORF Clone

SKU
RC207037
NAPA (Myc-DDK-tagged)-Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Alpha SNAP
Synonyms SNAPA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207037 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAATTCCGGGAAGGAAGCGGAGGCGATGGCGCTGTTGGCCGAGGCGGAGCGCAAAGTGAAGAACT
CGCAGTCCTTCTTCTCTGGCCTCTTTGGAGGCTCATCCAAAATAGAGGAAGCATGCGAAATCTACGCCAG
AGCAGCAAACATGTTCAAAATGGCCAAAAACTGGAGTGCTGCTGGAAACGCGTTCTGCCAGGCTGCACAG
CTGCACCTGCAGCTCCAGAGCAAGCACGACGCAGCCACCTGCTTTGTGGACGCTGGCAACGCATTCAAGA
AAGCCGACCCCCAAGAGGCCATTAACTGTTTGATGCGAGCAATCGAGATCTACACAGACATGGGCCGATT
CACGATTGCGGCCAAGCACCACATCTCCATTGCTGAGATCTATGAGACAGAGTTGGTGGACATCGAGAAG
GCCATTGCCCACTACGAGCAGTCTGCAGACTACTACAAAGGCGAGGAGTCCAACAGCTCAGCCAACAAGT
GTCTGCTGAAGGTGGCTGGTTACGCTGCGCTGCTGGAGCAGTATCAGAAGGCCATTGACATCTACGAACA
GGTGGGGACCAATGCCATGGACAGCCCCCTCCTCAAGTACAGCGCCAAAGACTACTTCTTCAAGGCGGCC
CTCTGCCACTTCTGCATCGACATGCTCAACGCCAAGCTGGCTGTCCAAAAGTATGAGGAGCTGTTCCCAG
CTTTCTCTGATTCCCGGGAATGCAAGTTGATGAAAAAATTGCTAGAGGCCCACGAGGAGCAGAATGTGGA
CAGCTACACCGAGTCGGTGAAGGAATACGACTCCATCTCCCGGCTGGACCAGTGGCTCACCACCATGCTG
CTGCGCATCAAGAAGACCATCCAGGGCGATGAGGAGGACCTGCGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207037 protein sequence
Red=Cloning site Green=Tags(s)

MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQ
LHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEK
AIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAA
LCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTML
LRIKKTIQGDEEDLR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_003827
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003827.4
RefSeq Size 1865 bp
RefSeq ORF 888 bp
Locus ID 8775
UniProt ID P54920
Cytogenetics 19q13.32-q13.33
Domains NSF
MW 33.2 kDa
Summary This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jun 2011]
Write Your Own Review
You're reviewing:Alpha SNAP (NAPA) (NM_003827) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207037L1 Lenti ORF clone of Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), Myc-DDK-tagged 10 ug
$600.00
RC207037L2 Lenti ORF clone of Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mGFP tagged 10 ug
$600.00
RC207037L3 Lenti ORF clone of Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), Myc-DDK-tagged 10 ug
$600.00
RC207037L4 Lenti ORF clone of Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA), mGFP tagged 10 ug
$600.00
RG207037 NAPA (tGFP-tagged) - Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127043 NAPA (untagged)-Human N-ethylmaleimide-sensitive factor attachment protein, alpha (NAPA) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.