SLC25A16 (NM_152707) Human Tagged ORF Clone

SKU
RC206966
SLC25A16 (Myc-DDK-tagged)-Human solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLC25A16
Synonyms D10S105E; GDA; GDC; HGT.1; hML7; ML7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206966 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCGACGGCCGCGGCAGCCCTGGCGGCGGCCGATCCCCCTCCCGCAATGCCGCAGGCGGCAG
GGGCCGGAGGGCCCACAACCCGCAGAGACTTCTACTGGCTGCGCTCCTTTCTGGCCGGAGGTATTGCTGG
ATGCTGTGCCAAAACAACAGTTGCTCCATTGGATCGAGTAAAGGTTTTATTACAAGCTCACAATCACCAT
TACAAGCATTTAGGAGTATTTTCTGCATTGCGTGCTGTTCCTCAAAAAGAAGGATTCCTTGGATTGTATA
AAGGAAATGGTGCAATGATGATTCGAATCTTTCCCTATGGTGCAATCCAGTTTATGGCATTTGAGCATTA
TAAAACGTTAATTACTACGAAGCTGGGAATTTCAGGTCATGTGCACAGATTAATGGCTGGATCCATGGCA
GGTATGACAGCAGTTATCTGTACTTACCCTCTTGACATGGTTAGGGTCCGCCTAGCATTCCAGGTGAAAG
GGGAACACAGCTATACAGGAATTATTCATGCTTTCAAAACAATTTATGCAAAGGAAGGTGGTTTCTTTGG
ATTTTACAGAGGTCTGATGCCTACTATTTTAGGAATGGCTCCATATGCAGGTGTTTCATTTTTTACTTTT
GGTACCTTGAAGAGTGTTGGGCTTTCCCATGCTCCTACCCTTCTTGGCAGACCTTCATCAGACAATCCTA
ATGTCTTAGTTTTGAAAACTCATGTAAACTTACTTTGTGGTGGTGTTGCTGGAGCAATAGCGCAGACAAT
ATCCTACCCATTTGATGTGACTCGTCGGCGAATGCAATTAGGAACTGTTCTGCCGGAATTTGAAAAGTGC
CTTACCATGCGGGATACTATGAAGTATGTCTATGGACACCATGGAATTCGAAAAGGACTCTATCGTGGTT
TATCTCTTAATTACATTCGCTGTATTCCCTCTCAAGCAGTGGCTTTTACAACATACGAACTTATGAAGCA
GTTTTTTCACCTCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206966 protein sequence
Red=Cloning site Green=Tags(s)

MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHH
YKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMA
GMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTF
GTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKC
LTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152707
ORF Size 996 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152707.4
RefSeq Size 2264 bp
RefSeq ORF 999 bp
Locus ID 8034
UniProt ID P16260
Cytogenetics 10q21.3
Protein Families Druggable Genome
MW 36.2 kDa
Summary This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SLC25A16 (NM_152707) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206966L1 Lenti ORF clone of Human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC206966L2 Lenti ORF clone of Human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC206966L3 Lenti ORF clone of Human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC206966L4 Lenti ORF clone of Human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG206966 SLC25A16 (tGFP-tagged) - Human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC309189 SLC25A16 (untagged)-Human solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.