RGS5 (NM_003617) Human Tagged ORF Clone

  • Product Brand Image
SKU
RC206857
RGS5 (Myc-DDK-tagged)-Human regulator of G-protein signaling 5 (RGS5), transcript variant 1
  $300.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RGS5
Synonyms MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206857 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCAAAGGACTTGCAGCTTTGCCCCACTCATGCCTGGAAAGGGCCAAGGAGATTAAGATCAAGTTGG
GAATTCTCCTCCAGAAGCCAGACTCAGTTGGTGACCTTGTCATTCCGTACAATGAGAAGCCAGAGAAACC
AGCCAAGACCCAGAAAACCTCGCTGGACGAGGCCCTGCAGTGGCGTGATTCCCTGGACAAACTCCTGCAG
AACAACTATGGACTTGCCAGTTTCAAAAGTTTCCTGAAGTCTGAATTCAGTGAGGAAAACCTTGAGTTCT
GGATTGCCTGTGAGGATTACAAGAAGATCAAGTCCCCTGCCAAGATGGCTGAGAAGGCAAAGCAAATTTA
TGAAGAATTCATTCAAACGGAGGCTCCTAAAGAGGTGAATATTGACCACTTCACTAAGGACATCACAATG
AAGAACCTGGTGGAACCTTCCCTGAGCAGCTTTGACATGGCCCAGAAAAGAATCCATGCCCTGATGGAAA
AGGATTCTCTGCCTCGCTTTGTGCGCTCTGAGTTTTATCAGGAGTTAATCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206857 protein sequence
Red=Cloning site Green=Tags(s)

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ
NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM
KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003617
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003617.4
RefSeq Size 5927 bp
RefSeq ORF 546 bp
Locus ID 8490
UniProt ID O15539
Cytogenetics 1q23.3
Domains RGS
Protein Families Druggable Genome
MW 20.9 kDa
Summary This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants have been identified. provided by RefSeq, Dec 2011
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_003617" in other vectors (6)
SKU Description Size Price
RC206857L1 Lenti ORF clone of Human regulator of G-protein signaling 5 (RGS5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206857L2 Lenti ORF clone of Human regulator of G-protein signaling 5 (RGS5), transcript variant 1, mGFP tagged 10 ug
$600.00
RC206857L3 Lenti ORF clone of Human regulator of G-protein signaling 5 (RGS5), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206857L4 Lenti ORF clone of Human regulator of G-protein signaling 5 (RGS5), transcript variant 1, mGFP tagged 10 ug
$600.00
RG206857 RGS5 (tGFP-tagged) - Human regulator of G-protein signaling 5 (RGS5), transcript variant 1 10 ug
$489.00 $500.00
SC117891 RGS5 (untagged)-Human regulator of G-protein signaling 5 (RGS5), transcript variant 1 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.