MAPK11 (NM_002751) Human Tagged ORF Clone

SKU
RC206583
MAPK11 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 11 (MAPK11)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAPK11
Synonyms p38-2; P38B; p38Beta; P38BETA2; PRKM11; SAPK2; SAPK2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206583 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGCCCTCGCGCCGGCTTCTACCGGCAGGAGCTGAACAAGACCGTGTGGGAGGTGCCGCAGCGGC
TGCAGGGGCTGCGCCCGGTGGGCTCCGGCGCCTACGGCTCCGTCTGTTCGGCCTACGACGCCCGGCTGCG
CCAGAAGGTGGCGGTGAAGAAGCTGTCGCGCCCCTTCCAGTCGCTGATCCACGCGCGCAGAACGTACCGG
GAGCTGCGGCTGCTCAAGCACCTGAAGCACGAGAACGTCATCGGGCTTCTGGACGTCTTCACGCCGGCCA
CGTCCATCGAGGACTTCAGCGAAGTGTACTTGGTGACCACCCTGATGGGCGCCGACCTGAACAACATCGT
CAAGTGCCAGGCGCTGAGCGACGAGCACGTTCAATTCCTGGTTTACCAGCTGCTGCGCGGGCTGAAGTAC
ATCCACTCGGCCGGGATCATCCACCGGGACCTGAAGCCCAGCAACGTGGCTGTGAACGAGGACTGTGAGC
TCAGGATCCTGGATTTCGGGCTGGCGCGCCAGGCGGACGAGGAGATGACCGGCTATGTGGCCACGCGCTG
GTACCGGGCACCTGAGATCATGCTCAACTGGATGCATTACAACCAAACAGTGGATATCTGGTCCGTGGGC
TGCATCATGGCTGAGCTGCTCCAGGGCAAGGCCCTCTTCCCGGGAAGCGACTACATTGACCAGCTGAAGC
GCATCATGGAAGTGGTGGGCACACCCAGCCCTGAGGTTCTGGCAAAAATCTCCTCAGAACACGCCCGGAC
ATATATCCAGTCCCTGCCCCCCATGCCCCAGAAGGACCTGAGCAGCATCTTCCGTGGAGCCAACCCCCTG
GCCATAGACCTCCTTGGAAGGATGCTGGTGCTGGACAGTGACCAGAGGGTCAGTGCAGCTGAGGCACTGG
CCCACGCCTACTTCAGCCAGTACCACGACCCCGAGGATGAGCCAGAGGCCGAGCCATATGATGAGAGCGT
TGAGGCCAAGGAGCGCACGCTGGAGGAGTGGAAGGAGCTCACTTACCAGGAAGTCCTCAGCTTCAAGCCC
CCAGAGCCACCGAAGCCACCTGGCAGCCTGGAGATTGAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206583 protein sequence
Red=Cloning site Green=Tags(s)

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYR
ELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKY
IHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG
CIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPL
AIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP
PEPPKPPGSLEIEQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002751
ORF Size 1092 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002751.6
RefSeq Size 2463 bp
RefSeq ORF 1095 bp
Locus ID 5600
UniProt ID Q15759
Cytogenetics 22q13.33
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway
MW 41.4 kDa
Summary This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Write Your Own Review
You're reviewing:MAPK11 (NM_002751) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206583L1 Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), Myc-DDK-tagged 10 ug
$986.00
RC206583L2 Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), mGFP tagged 10 ug
$986.00
RC206583L3 Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), Myc-DDK-tagged 10 ug
$986.00
RC206583L4 Lenti ORF clone of Human mitogen-activated protein kinase 11 (MAPK11), mGFP tagged 10 ug
$986.00
RG206583 MAPK11 (tGFP-tagged) - Human mitogen-activated protein kinase 11 (MAPK11) 10 ug
$886.00
SC118466 MAPK11 (untagged)-Human mitogen-activated protein kinase 11 (MAPK11) 10 ug
$686.00
SC324181 MAPK11 (untagged)-Human mitogen-activated protein kinase 11 (MAPK11) 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.