CISH (NM_145071) Human Tagged ORF Clone

SKU
RC206496
CISH (Myc-DDK-tagged)-Human cytokine inducible SH2-containing protein (CISH), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CISH
Synonyms BACTS2; CIS; CIS-1; G18; SOCS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206496 representing NM_145071
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTCTGCGTTCAGGGACCTCGTCCTTTGCTGGCTGTGGAGCGGACTGGGCAGCGGCCCCTGTGGG
CCCCGTCCCTGGAACTGCCCAAGCCAGTCATGCAGCCCTTGCCTGCTGGGGCCTTCCTCGAGGAGGTGGC
AGAGGGTACCCCAGCCCAGACAGAGAGTGAGCCAAAGGTGCTGGACCCAGAGGAGGATCTGCTGTGCATA
GCCAAGACCTTCTCCTACCTTCGGGAATCTGGCTGGTATTGGGGTTCCATTACGGCCAGCGAGGCCCGAC
AACACCTGCAGAAGATGCCAGAAGGCACGTTCTTAGTACGTGACAGCACGCACCCCAGCTACCTGTTCAC
GCTGTCAGTGAAAACCACTCGTGGCCCCACCAATGTACGCATTGAGTATGCTGACTCCAGCTTCCGTCTG
GACTCCAACTGCTTGTCCAGGCCACGCATCCTGGCCTTTCCGGATGTGGTCAGCCTTGTGCAGCACTATG
TGGCCTCCTGCACTGCTGATACCCGAAGCGACAGCCCCGATCCTGCTCCCACCCCGGCCCTGCCTATGCC
TAAGGAGGATGCGCCTAGTGACCCAGCACTGCCTGCTCCTCCACCAGCCACTGCTGTACACCTAAAACTG
GTGCAGCCCTTTGTACGCAGAAGCAGCGCCCGCAGCCTGCAACACCTGTGCCGCCTTGTCATCAACCGTC
TGGTGGCCGACGTGGACTGCCTGCCACTGCCCCGGCGCATGGCCGACTACCTCCGACAGTACCCCTTCCA
GCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206496 representing NM_145071
Red=Cloning site Green=Tags(s)

MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCI
AKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRL
DSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKL
VQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145071
ORF Size 774 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145071.4
RefSeq Size 2035 bp
RefSeq ORF 777 bp
Locus ID 1154
UniProt ID Q9NSE2
Cytogenetics 3p21.2
Domains SH2, SOCS
Protein Families Druggable Genome
Protein Pathways Jak-STAT signaling pathway
MW 28.5 kDa
Summary The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Write Your Own Review
You're reviewing:CISH (NM_145071) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC206496L1 Lenti ORF clone of Human cytokine inducible SH2-containing protein (CISH), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC206496L2 Lenti ORF clone of Human cytokine inducible SH2-containing protein (CISH), transcript variant 2, mGFP tagged 10 ug
$600.00
RC206496L3 Lenti ORF clone of Human cytokine inducible SH2-containing protein (CISH), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC206496L4 Lenti ORF clone of Human cytokine inducible SH2-containing protein (CISH), transcript variant 2, mGFP tagged 10 ug
$600.00
RG206496 CISH (tGFP-tagged) - Human cytokine inducible SH2-containing protein (CISH), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124560 CISH (untagged)-Human cytokine inducible SH2-containing protein (CISH), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.