Myosin Light Chain 2 (MYL2) (NM_000432) Human Tagged ORF Clone

SKU
RC205932
MYL2 (Myc-DDK-tagged)-Human myosin, light chain 2, regulatory, cardiac, slow (MYL2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Myosin Light Chain 2
Synonyms CMH10; MLC-2s/v; MLC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205932 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCTAAGAAAGCAAAGAAGAGAGCCGGGGGCGCCAACTCCAACGTGTTCTCCATGTTCGAACAGA
CCCAAATCCAGGAATTTAAGGAGGCCTTCACTATCATGGACCAGAACAGGGATGGCTTCATTGACAAGAA
CGATCTGAGAGACACCTTTGCTGCCCTTGGGCGAGTGAACGTGAAAAATGAAGAAATTGATGAAATGATC
AAGGAGGCTCCGGGTCCAATTAACTTTACTGTGTTCCTCACAATGTTTGGGGAGAAACTTAAGGGAGCGG
ACCCTGAGGAAACCATTCTCAACGCATTCAAAGTGTTTGACCCTGAAGGCAAAGGGGTGCTGAAGGCTGA
TTACGTTCGGGAAATGCTGACCACGCAGGCGGAGAGGTTTTCCAAGGAGGAGGTTGACCAGATGTTCGCC
GCCTTCCCCCCTGACGTGACTGGCAACTTGGACTACAAGAACCTGGTGCACATCATCACCCACGGAGAAG
AGAAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205932 protein sequence
Red=Cloning site Green=Tags(s)

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA
AFPPDVTGNLDYKNLVHIITHGEEKD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000432
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000432.4
RefSeq Size 855 bp
RefSeq ORF 501 bp
Locus ID 4633
UniProt ID P10916
Cytogenetics 12q24.11
Domains EFh
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction
MW 18.8 kDa
Summary Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Myosin Light Chain 2 (MYL2) (NM_000432) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205932L1 Lenti ORF clone of Human myosin, light chain 2, regulatory, cardiac, slow (MYL2), Myc-DDK-tagged 10 ug
$450.00
RC205932L2 Lenti ORF clone of Human myosin, light chain 2, regulatory, cardiac, slow (MYL2), mGFP tagged 10 ug
$450.00
RC205932L3 Lenti ORF clone of Human myosin, light chain 2, regulatory, cardiac, slow (MYL2), Myc-DDK-tagged 10 ug
$450.00
RC205932L4 Lenti ORF clone of Human myosin, light chain 2, regulatory, cardiac, slow (MYL2), mGFP tagged 10 ug
$450.00
RG205932 MYL2 (tGFP-tagged) - Human myosin, light chain 2, regulatory, cardiac, slow (MYL2) 10 ug
$489.00
SC119884 MYL2 (untagged)-Human myosin, light chain 2, regulatory, cardiac, slow (MYL2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.