ST2 (IL1RL1) (NM_003856) Human Tagged ORF Clone

SKU
RC205916
IL1RL1 (Myc-DDK-tagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ST2
Synonyms DER4; FIT-1; IL33R; ST2; ST2L; ST2V; T1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205916 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTTTTGGATCTTAGCAATTCTCACAATTCTCATGTATTCCACAGCAGCAAAGTTTAGTAAACAAT
CATGGGGCCTGGAAAATGAGGCTTTAATTGTAAGATGTCCTAGACAAGGAAAACCTAGTTACACCGTGGA
TTGGTATTACTCACAAACAAACAAAAGTATTCCCACTCAGGAAAGAAATCGTGTGTTTGCCTCAGGCCAA
CTTCTGAAGTTTCTACCAGCTGCAGTTGCTGATTCTGGTATTTATACCTGTATTGTCAGAAGTCCCACAT
TCAATAGGACTGGATATGCGAATGTCACCATATATAAAAAACAATCAGATTGCAATGTTCCAGATTATTT
GATGTATTCAACAGTATCTGGATCAGAAAAAAATTCCAAAATTTATTGTCCTACCATTGACCTCTACAAC
TGGACAGCACCTCTTGAGTGGTTTAAGAATTGTCAGGCTCTTCAAGGATCAAGGTACAGGGCGCACAAGT
CATTTTTGGTCATTGATAATGTGATGACTGAGGACGCAGGTGATTACACCTGTAAATTTATACACAATGA
AAATGGAGCCAATTATAGTGTGACGGCGACCAGGTCCTTCACGGTCAAGGATGAGCAAGGCTTTTCTCTG
TTTCCAGTAATCGGAGCCCCTGCACAAAATGAAATAAAGGAAGTGGAAATTGGAAAAAACGCAAACCTAA
CTTGCTCTGCTTGTTTTGGAAAAGGCACTCAGTTCTTGGCTGCCGTCCTGTGGCAGCTTAATGGAACAAA
AATTACAGACTTTGGTGAACCAAGAATTCAACAAGAGGAAGGGCAAAATCAAAGTTTCAGCAATGGGCTG
GCTTGTCTAGACATGGTTTTAAGAATAGCTGACGTGAAGGAAGAGGATTTATTGCTGCAGTACGACTGTC
TGGCCCTGAATTTGCATGGCTTGAGAAGGCACACCGTAAGACTAAGTAGGAAAAATCCAAGTAAGGAGTG
TTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205916 protein sequence
Red=Cloning site Green=Tags(s)

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQ
LLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYN
WTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSL
FPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGL
ACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003856
ORF Size 984 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003856.4
RefSeq Size 3909 bp
RefSeq ORF 987 bp
Locus ID 9173
UniProt ID Q01638
Cytogenetics 2q12.1
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 37 kDa
Summary The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ST2 (IL1RL1) (NM_003856) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205916L1 Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC205916L2 Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, mGFP tagged 10 ug
$600.00
RC205916L3 Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC205916L4 Lenti ORF clone of Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2, mGFP tagged 10 ug
$600.00
RG205916 IL1RL1 (tGFP-tagged) - Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127817 IL1RL1 (untagged)-Human interleukin 1 receptor-like 1 (IL1RL1), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.