UCMA (NM_145314) Human Tagged ORF Clone
SKU
RC205431
UCMA (Myc-DDK-tagged)-Human upper zone of growth plate and cartilage matrix associated (UCMA)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | UCMA |
Synonyms | C10orf49; GRP; GRP/UCMA |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC205431 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTTGGAGACAGGCCGTCCTGCTGTCTTGCTTCTCCGCCGTGGTGCTCCTGTCTATGCTGAGAGAGG GAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAGAT TTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCCGAGAT GAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAA GGAATGAATTTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGA GCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCATCCTATCTCTACAACCGCCACCACACG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205431 protein sequence
Red=Cloning site Green=Tags(s) MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRD EVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_145314 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_145314.1, NP_660357.2 |
RefSeq Size | 840 bp |
RefSeq ORF | 417 bp |
Locus ID | 221044 |
UniProt ID | Q8WVF2 |
Cytogenetics | 10p13 |
Protein Families | Secreted Protein |
MW | 16.6 kDa |
Summary | This gene encodes a chondrocyte-specific, highly charged protein that is abundantly expressed in the upper immature zone of fetal and juvenile epiphyseal cartilage. The encoded protein undergoes proteolytic processing to generate a mature protein that is secreted into the extracellular matrix. The glutamic acid residues in the encoded protein undergo gamma carboxylation in a vitamin K-dependent manner. Undercarboxylation of the encoded protein is associated with osteoarthritis in humans. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC205431L3 | Lenti ORF clone of Human upper zone of growth plate and cartilage matrix associated (UCMA), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC205431L4 | Lenti ORF clone of Human upper zone of growth plate and cartilage matrix associated (UCMA), mGFP tagged | 10 ug |
$450.00
|
|
RG205431 | UCMA (tGFP-tagged) - Human upper zone of growth plate and cartilage matrix associated (UCMA) | 10 ug |
$489.00
|
|
SC123227 | UCMA (untagged)-Human upper zone of growth plate and cartilage matrix associated (UCMA) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.