UCMA (NM_145314) Human Tagged ORF Clone

SKU
RG205431
UCMA (tGFP-tagged) - Human upper zone of growth plate and cartilage matrix associated (UCMA)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UCMA
Synonyms C10orf49; GRP; GRP/UCMA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG205431 representing NM_145314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTGGAGACAGGCCGTCCTGCTGTCTTGCTTCTCCGCCGTGGTGCTCCTGTCTATGCTGAGAGAGG
GAACCAGTGTATCTGTGGGCACCATGCAGATGGCGGGAGAAGAGGCGAGTGAAGATGCAAAACAGAAGAT
TTTCATGCAGGAATCAGATGCCTCGAATTTCCTCAAGAGGCGCGGCAAGCGGTCCCCCAAGTCCCGAGAT
GAGGTCAATGTGGAAAACAGGCAGAAGCTTCGGGTTGATGAGCTGCGGAGAGAATATTACGAGGAACAAA
GGAATGAATTTGAGAACTTCGTGGAGGAACAAAACGATGAGCAGGAAGAGAGGAGCCGGGAGGCTGTGGA
GCAGTGGCGCCAGTGGCACTATGACGGCCTGCACCCATCCTATCTCTACAACCGCCACCACACG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG205431 representing NM_145314
Red=Cloning site Green=Tags(s)

MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRD
EVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145314
ORF Size 414 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145314.1, NP_660357.2
RefSeq Size 840 bp
RefSeq ORF 417 bp
Locus ID 221044
UniProt ID Q8WVF2
Cytogenetics 10p13
Protein Families Secreted Protein
Summary This gene encodes a chondrocyte-specific, highly charged protein that is abundantly expressed in the upper immature zone of fetal and juvenile epiphyseal cartilage. The encoded protein undergoes proteolytic processing to generate a mature protein that is secreted into the extracellular matrix. The glutamic acid residues in the encoded protein undergo gamma carboxylation in a vitamin K-dependent manner. Undercarboxylation of the encoded protein is associated with osteoarthritis in humans. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2015]
Write Your Own Review
You're reviewing:UCMA (NM_145314) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205431 UCMA (Myc-DDK-tagged)-Human upper zone of growth plate and cartilage matrix associated (UCMA) 10 ug
$150.00
RC205431L3 Lenti ORF clone of Human upper zone of growth plate and cartilage matrix associated (UCMA), Myc-DDK-tagged 10 ug
$450.00
RC205431L4 Lenti ORF clone of Human upper zone of growth plate and cartilage matrix associated (UCMA), mGFP tagged 10 ug
$450.00
SC123227 UCMA (untagged)-Human upper zone of growth plate and cartilage matrix associated (UCMA) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.