Dexras1 (RASD1) (NM_016084) Human Tagged ORF Clone

SKU
RC205285
RASD1 (Myc-DDK-tagged)-Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Dexras1
Synonyms AGS1; DEXRAS1; MGC:26290
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205285 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTGGCCGCGATGATCAAGAAGATGTGCCCGAGCGACTCGGAGCTGAGTATCCCGGCCAAGAACT
GCTATCGCATGGTCATCCTCGGCTCGTCCAAGGTGGGCAAGACGGCCATCGTGTCGCGCTTCCTCACCGG
CCGCTTCGAGGACGCCTACACGCCTACCATCGAGGACTTCCACCGCAAGTTCTACTCCATCCGCGGCGAG
GTCTACCAGCTCGACATCCTCGACACGTCCGGCAACCACCCGTTCCCCGCCATGCGGCGCCTCTCCATCC
TCACAGGAGACGTTTTCATCCTGGTGTTCAGTCTGGACAACCGCGACTCCTTCGAGGAGGTGCAGCGGCT
CAGGCAGCAGATCCTCGACACCAAGTCTTGCCTCAAGAACAAAACCAAGGAGAACGTGGACGTGCCCCTG
GTCATCTGCGGCAACAAGGGTGACCGCGACTTCTACCGCGAGGTGGACCAGCGCGAGATCGAGCAGCTGG
TGGGCGACGACCCCCAGCGCTGCGCCTACTTCGAGATCTCGGCCAAGAAGAACAGCAGCCTGGACCAGAT
GTTCCGCGCGCTCTTCGCCATGGCCAAGCTGCCCAGCGAGATGAGCCCAGACCTGCACCGCAAGGTCTCG
GTGCAGTACTGCGACGTGCTGCACAAGAAGGCGCTGCGGAACAAGAAGCTGCTGCGGGCCGGCAGCGGCG
GCGGCGGCGGCGACCCGGGCGACGCCTTTGGCATCGTGGCACCCTTCGCGCGCCGGCCCAGCGTACACAG
CGACCTCATGTACATCCGCGAGAAGGCCAGCGCCGGCAGCCAGGCCAAGGACAAGGAGCGCTGCGTCATC
AGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205285 protein sequence
Red=Cloning site Green=Tags(s)

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGE
VYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPL
VICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVS
VQYCDVLHKKALRNKKLLRAGSGGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASAGSQAKDKERCVI
S

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016084
ORF Size 843 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016084.5
RefSeq Size 1814 bp
RefSeq ORF 846 bp
Locus ID 51655
UniProt ID Q9Y272
Cytogenetics 17p11.2
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 31.6 kDa
Summary This gene encodes a member of the Ras superfamily of small GTPases and is induced by dexamethasone. The encoded protein is an activator of G-protein signaling and acts as a direct nucleotide exchange factor for Gi-Go proteins. This protein interacts with the neuronal nitric oxide adaptor protein CAPON, and a nuclear adaptor protein FE65, which interacts with the Alzheimer's disease amyloid precursor protein. This gene may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. Epigenetic inactivation of this gene is closely correlated with resistance to dexamethasone in multiple myeloma cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2011]
Write Your Own Review
You're reviewing:Dexras1 (RASD1) (NM_016084) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205285L1 Lenti ORF clone of Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205285L2 Lenti ORF clone of Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC205285L3 Lenti ORF clone of Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205285L4 Lenti ORF clone of Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG205285 RASD1 (tGFP-tagged) - Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114441 RASD1 (untagged)-Human RAS, dexamethasone-induced 1 (RASD1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.