TEF (NM_003216) Human Tagged ORF Clone

SKU
RC205147
TEF (Myc-DDK-tagged)-Human thyrotrophic embryonic factor (TEF), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TEF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205147 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGACGCGGGCGGCGGAAAGAAGCCGCCTGTGGACCCGCAGGCAGGACCCGGTCCGGGGCCGGGGC
GCGCAGCTGGGGAAAGGGGCCTGTCGGGGTCCTTCCCCCTGGTCCTGAAGAAGCTGATGGAGAACCCCCC
GCGCGAGGCGCGCCTCGATAAGGAAAAGGGGAAGGAAAAGCTGGAGGAGGACGAGGCCGCAGCCGCCAGC
ACCATGGCTGTCTCAGCCTCCCTCATGCCACCCATCTGGGACAAGACCATCCCATATGATGGCGAATCTT
TCCACCTGGAGTACATGGACCTGGATGAGTTCCTGCTGGAGAATGGCATCCCCGCCAGCCCCACCCACCT
GGCCCACAACCTGCTGCTGCCTGTAGCAGAGCTAGAAGGGAAGGAGTCTGCCAGCTCTTCCACAGCATCC
CCACCATCCTCCTCCACTGCCATCTTTCAGCCCTCTGAAACTGTGTCCAGCACAGAATCTTCCCTGGAGA
AGGAGAGGGAGACTCCCAGTCCCATCGACCCCAATTGTGTGGAAGTGGATGTGAACTTCAATCCGGACCC
CGCCGACCTGGTGCTCTCCAGTGTGCCAGGCGGGGAGCTCTTCAACCCTCGGAAGCACAAGTTTGCTGAG
GAGGACCTGAAGCCCCAGCCTATGATCAAAAAGGCCAAGAAGGTCTTTGTCCCCGACGAGCAGAAGGATG
AAAAGTACTGGACAAGACGCAAGAAGAACAACGTGGCAGCTAAACGGTCACGGGATGCCCGGCGCCTGAA
AGAGAATCAGATCACCATCCGGGCAGCCTTCCTGGAGAAGGAGAACACAGCCCTGCGGACGGAGGTGGCC
GAGCTACGCAAGGAGGTGGGCAAGTGCAAGACCATCGTGTCCAAGTATGAGACCAAATACGGGCCCTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205147 protein sequence
Red=Cloning site Green=Tags(s)

MSDAGGGKKPPVDPQAGPGPGPGRAAGERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAAS
TMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAELEGKESASSSTAS
PPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE
EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVA
ELRKEVGKCKTIVSKYETKYGPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003216
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003216.4
RefSeq Size 4404 bp
RefSeq ORF 912 bp
Locus ID 7008
UniProt ID Q10587
Cytogenetics 22q13.2
Protein Families Transcription Factors
MW 33.2 kDa
Summary This gene encodes a member of the PAR (proline and acidic amino acid-rich) subfamily of basic region/leucine zipper (bZIP) transcription factors. It is expressed in a broad range of cells and tissues in adult animals, however, during embryonic development, TEF expression appears to be restricted to the developing anterior pituitary gland, coincident with the appearance of thyroid-stimulating hormone, beta (TSHB). Indeed, TEF can bind to, and transactivate the TSHB promoter. It shows homology (in the functional domains) with other members of the PAR-bZIP subfamily of transcription factors, which include albumin D box-binding protein (DBP), human hepatic leukemia factor (HLF) and chicken vitellogenin gene-binding protein (VBP); VBP is considered the chicken homologue of TEF. Different members of the subfamily can readily form heterodimers, and share DNA-binding, and transcriptional regulatory properties. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:TEF (NM_003216) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205147L3 Lenti ORF clone of Human thyrotrophic embryonic factor (TEF), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC205147L4 Lenti ORF clone of Human thyrotrophic embryonic factor (TEF), transcript variant 1, mGFP tagged 10 ug
$600.00
RG205147 TEF (tGFP-tagged) - Human thyrotrophic embryonic factor (TEF), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC303285 TEF (untagged)-Human thyrotrophic embryonic factor (TEF), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.