HLA-DPB1 (NM_002121) Human Tagged ORF Clone

SKU
RC204966
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HLA-DPB1
Synonyms DPB1; HLA-DP; HLA-DP1B; HLA-DPB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204966 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACAT
CTGTGGTCCAGGGCAGGGCCACTCCAGAGAATTACGTGCACCAGTTACGGCAGGAATGCTACGCGTTTAA
TGGGACACAGCGCTTCCTGGAGAGATACATCTACAACCGGGAGGAGTTCGTGCGCTTCGACAGCGACGTG
GGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTACTGGAACAGCCAGAAGGACATCC
TGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACGAGGCCGTGACCCT
GCAGCGCCGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAACCTG
CTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGG
AAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGATGCT
GGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCCTGGATAGTCCTGTC
ACCGTGGAGTGGAAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGC
TGGGGCTCATCATCTGTGGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGC
A


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204966 protein sequence
Red=Cloning site Green=Tags(s)

MVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDV
GEFRAVTELGRPDEDYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNL
LVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPV
TVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_002121
ORF Size 771 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 4055 bp
RefSeq ORF 777 bp
Locus ID 3115
UniProt ID P04440
Cytogenetics 6p21.32
Domains ig, IGc1, MHC_II_beta
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
MW 29.2 kDa
Summary HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HLA-DPB1 (NM_002121) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204966L1 Lenti ORF clone of Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), Myc-DDK-tagged 10 ug
$600.00
RC204966L2 Lenti ORF clone of Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mGFP tagged 10 ug
$600.00
RC204966L3 Lenti ORF clone of Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), Myc-DDK-tagged 10 ug
$600.00
RC204966L4 Lenti ORF clone of Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1), mGFP tagged 10 ug
$600.00
RG204966 HLA (tGFP-tagged) - Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118846 HLA (untagged)-Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1) 10 ug
$300.00
SC320914 HLA (untagged)-Human major histocompatibility complex, class II, DP beta 1 (HLA-DPB1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.