Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone

SKU
RC204932
PSMC4 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Tbp7
Synonyms MIP224; RPT3; S6; TBP-7; TBP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204932 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGATAGGCATCTTGGTGGAGAAGGCTCAGGATGAGATCCCAGCACTGTCCGTGTCCCGGCCCC
AGACCGGCCTGTCCTTCCTGGGCCCTGAGCCTGAGGACCTGGAGGACCTGTACAGCCGCTACAAGAAGCT
GCAGCAAGAGCTGGAGTTCCTGGAGGTGCAGGAGGAATACATCAAAGATGAGCAAAAGAACCTGAAAAAG
GAATTTCTCCATGCCCAGGAGGAGGTGAAGCGAATCCAAAGCATCCCGCTGGTCATCGGACAATTTCTGG
AGGCTGTGGATCAGAATACAGCCATCGTGGGCTCTACCACAGGCTCCAACTATTATGTGCGCATCCTGAG
CACCATCGATCGGGAGCTGCTCAAGCCCAACGCCTCAGTGGCCCTCCACAAGCACAGCAATGCACTGGTG
GACGTGCTGCCCCCCGAAGCCGACAGCAGCATCATGATGCTCACCTCAGACCAGAAGCCAGATGTGATGT
ACGCGGACATCGGAGGCATGGACATCCAGAAGCAGGAGGTGCGGGAGGCCGTGGAGCTCCCGCTCACGCA
TTTCGAGCTCTACAAGCAGATCGGCATCGATCCCCCCCGAGGCGTCCTCATGTATGGCCCACCTGGCTGT
GGGAAGACCATGTTGGCAAAGGCGGTGGCACATCACACAACAGCTGCATTCATCCGGGTCGTGGGCTCGG
AGTTTGTACAGAAGTATCTGGGTGAGGGCCCCCGCATGGTCCGGGATGTGTTCCGCCTGGCCAAGGAGAA
TGCACCTGCCATCATCTTCATAGACGAGATTGATGCCATCGCCACCAAGAGATTCGATGCTCAGACAGGG
GCCGACAGGGAGGTTCAGAGGATCCTGCTGGAGCTGCTGAATCAGATGGATGGATTTGATCAGAATGTCA
ATGTCAAGGTAATCATGGCCACAAACAGAGCAGACACCCTGGATCCGGCCCTGCTACGGCCAGGACGGCT
GGACCGTAAAATTGAATTTCCACTTCCTGACCGCCGCCAGAAGAGATTGATTTTCTCCACTATCACTAGC
AAGATGAACCTCTCTGAGGAGGTTGACTTGGAAGACTATGTGGCCCGGCCAGATAAGATTTCAGGAGCTG
ATATTAACTCCATCTGTCAGGAGAGTGGAATGTTGGCTGTCCGTGAAAACCGCTACATTGTCCTGGCCAA
GGACTTCGAGAAAGCATACAAGACTGTCATCAAGAAGGACGAGCAGGAGCATGAGTTTTACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204932 protein sequence
Red=Cloning site Green=Tags(s)

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKK
EFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALV
DVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGC
GKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTG
ADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITS
KMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006503
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006503.4
RefSeq Size 1914 bp
RefSeq ORF 1257 bp
Locus ID 5704
UniProt ID P43686
Cytogenetics 19q13.2
Domains AAA
Protein Families Druggable Genome
Protein Pathways Proteasome
MW 47.4 kDa
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the triple-A family of ATPases that is a component of the 19S regulatory subunit and plays a role in 26S proteasome assembly. The encoded protein interacts with gankyrin, a liver oncoprotein, and may also play a role in Parkinson's disease through interactions with synphilin-1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:Tbp7 (PSMC4) (NM_006503) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204932L1 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204932L2 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged 10 ug
$757.00
RC204932L3 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC204932L4 Lenti ORF clone of Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1, mGFP tagged 10 ug
$757.00
RG204932 PSMC4 (tGFP-tagged) - Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC319607 PSMC4 (untagged)-Human proteasome (prosome, macropain) 26S subunit, ATPase, 4 (PSMC4), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.