CD160 (NM_007053) Human Tagged ORF Clone

SKU
RC204886
CD160 (Myc-DDK-tagged)-Human CD160 molecule (CD160)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD160
Synonyms BY55; NK1; NK28
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204886 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTTGGAACCCGGCAGAGGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGGACATCCAGTCTG
GTGGATGCATTAACATCACCAGCTCAGCTTCCCAGGAAGGAACGCGACTAAACTTAATCTGTACTGTATG
GCATAAGAAAGAAGAGGCTGAGGGGTTTGTAGTGTTTTTGTGCAAGGACAGGTCTGGAGACTGTTCTCCT
GAGACCAGTTTAAAACAGCTGAGACTTAAAAGGGATCCTGGGATAGATGGTGTTGGTGAAATATCATCTC
AGTTGATGTTCACCATAAGCCAAGTCACACCGTTGCACAGTGGGACCTACCAGTGTTGTGCCAGAAGCCA
GAAGTCAGGTATCCGCCTTCAGGGCCATTTTTTCTCCATTCTATTCACAGAGACAGGGAACTACACAGTG
ACGGGATTGAAACAAAGACAACACCTTGAGTTCAGCCATAATGAAGGCACTCTCAGTTCAGGCTTCCTAC
AAGAAAAGGTCTGGGTAATGCTGGTCACCAGCCTTGTGGCCCTTCAAGCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204886 protein sequence
Red=Cloning site Green=Tags(s)

MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSP
ETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTV
TGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007053
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007053.4
RefSeq Size 1633 bp
RefSeq ORF 546 bp
Locus ID 11126
UniProt ID O95971
Cytogenetics 1q21.1
Protein Families Druggable Genome
MW 19.8 kDa
Summary CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CD160 (NM_007053) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204886L1 Lenti ORF clone of Human CD160 molecule (CD160), Myc-DDK-tagged 10 ug
$600.00
RC204886L2 Lenti ORF clone of Human CD160 molecule (CD160), mGFP tagged 10 ug
$600.00
RC204886L3 Lenti ORF clone of Human CD160 molecule (CD160), Myc-DDK-tagged 10 ug
$600.00
RC204886L4 Lenti ORF clone of Human CD160 molecule (CD160), mGFP tagged 10 ug
$600.00
RG204886 CD160 (tGFP-tagged) - Human CD160 molecule (CD160) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122768 CD160 (untagged)-Human CD160 molecule (CD160) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.