CLTRN (NM_020665) Human Tagged ORF Clone

SKU
RC204775
TMEM27 (Myc-DDK-tagged)-Human transmembrane protein 27 (TMEM27)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLTRN
Synonyms NX-17; NX17; TMEM27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204775 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGTGGCTGCTCTTTTTTCTGGTGACTGCCATTCATGCTGAACTCTGTCAACCAGGTGCAGAAAATG
CTTTTAAAGTGAGACTTAGTATCAGAACAGCTCTGGGAGATAAAGCATATGCCTGGGATACCAATGAAGA
ATACCTCTTCAAAGCGATGGTAGCTTTCTCCATGAGAAAAGTTCCCAACAGAGAAGCAACAGAAATTTCC
CATGTCCTACTTTGCAATGTAACCCAGAGGGTATCATTCTGGTTTGTGGTTACAGACCCTTCAAAAAATC
ACACCCTTCCTGCTGTTGAGGTGCAATCAGCCATAAGAATGAACAAGAACCGGATCAACAATGCCTTCTT
TCTAAATGACCAAACTCTGGAATTTTTAAAAATCCCTTCCACACTTGCACCACCCATGGACCCATCTGTG
CCCATCTGGATTATTATATTTGGTGTGATATTTTGCATCATCATAGTTGCAATTGCACTACTGATTTTAT
CAGGGATCTGGCAACGTAGAAGAAAGAACAAAGAACCATCTGAAGTGGATGACGCTGAAGATAAGTGTGA
AAACATGATCACAATTGAAAATGGCATCCCCTCTGATCCCCTGGACATGAAGGGAGGGCATATTAATGAT
GCCTTCATGACAGAGGATGAGAGGCTCACCCCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204775 protein sequence
Red=Cloning site Green=Tags(s)

MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEIS
HVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSV
PIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDPLDMKGGHIND
AFMTEDERLTPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020665
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020665.6
RefSeq Size 1580 bp
RefSeq ORF 669 bp
Locus ID 57393
UniProt ID Q9HBJ8
Cytogenetics Xp22.2
Protein Families Transmembrane
MW 25.2 kDa
Summary This gene encodes a type 1 transmembrane protein that is important for trafficking amino acid transporters to the apical brush border of proximal tubules. The encoded protein binds to amino acid transporters and regulates their expression on the plasma membrane. It also plays a role in controlling insulin exocytosis by regulating formation of the SNARE (soluble N-ethylmaleimide-sensitive-factor attachment protein receptor) complex in pancreatic beta cells. The extracellular domain of the encoded protein may be cleaved and shed from the plasma membrane specifically in pancreatic beta cells. [provided by RefSeq, Jun 2013]
Write Your Own Review
You're reviewing:CLTRN (NM_020665) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204775L1 Lenti ORF clone of Human transmembrane protein 27 (TMEM27), Myc-DDK-tagged 10 ug
$600.00
RC204775L2 Lenti ORF clone of Human transmembrane protein 27 (TMEM27), mGFP tagged 10 ug
$600.00
RC204775L3 Lenti ORF clone of Human transmembrane protein 27 (TMEM27), Myc-DDK-tagged 10 ug
$600.00
RC204775L4 Lenti ORF clone of Human transmembrane protein 27 (TMEM27), mGFP tagged 10 ug
$600.00
RG204775 TMEM27 (tGFP-tagged) - Human transmembrane protein 27 (TMEM27) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122895 TMEM27 (untagged)-Human transmembrane protein 27 (TMEM27) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.