CH25H (NM_003956) Human Tagged ORF Clone

SKU
RC204716
CH25H (Myc-DDK-tagged)-Human cholesterol 25-hydroxylase (CH25H)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CH25H
Synonyms C25H
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204716 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTGCCACAACTGCTCCGACCCCCAGGTCCTTTGCAGCTCCGGGCAGCTGTTCCTGCAGCCCCTCT
GGGACCACCTGAGGAGCTGGGAGGCCCTCCTACAGTCGCCCTTCTTCCCGGTCATCTTCTCCATCACCAC
ATACGTGGGCTTTTGCCTGCCCTTCGTGGTCCTGGATATCCTGTGCTCCTGGGTGCCCGCCCTGCGGCGC
TACAAGATCCACCCTGACTTCTCGCCATCCGCGCAGCAGCTGCTACCTTGCCTGGGGCAGACCCTCTACC
AGCATGTGATGTTTGTGTTCCCCGTGACGCTGCTGCATTGGGCCCGCAGCCCGGCCCTCCTGCCCCACGA
AGCTCCCGAGCTGCTCCTGCTGCTGCACCACATCCTGTTCTGCCTGCTACTCTTCGACATGGAGTTCTTC
GTGTGGCACCTGCTGCACCACAAGGTGCCCTGGCTGTACCGCACCTTCCACAAGGTGCACCACCAGAACT
CGTCCTCGTTCGCGCTGGCAACGCAGTATATGAGCGTCTGGGAACTGTTTTCTTTGGGCTTCTTCGACAT
GATGAACGTCACACTGCTCGGGTGCCACCCGCTCACCACCCTGACCTTCCACGTGGTCAACATCTGGCTT
TCCGTGGAGGACCACTCCGGCTACAACTTCCCTTGGTCCACTCACAGACTGGTGCCCTTCGGGTGGTACG
GGGGTGTGGTGCACCACGACCTGCATCACTCTCACTTTAACTGCAACTTCGCTCCGTACTTTACACACTG
GGACAAAATACTGGGAACGCTGCGGACTGCATCTGTCCCAGCGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204716 protein sequence
Red=Cloning site Green=Tags(s)

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR
YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF
VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL
SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003956
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003956.4
RefSeq Size 1378 bp
RefSeq ORF 819 bp
Locus ID 9023
UniProt ID O95992
Cytogenetics 10q23.31
Protein Families Transmembrane
Protein Pathways Primary bile acid biosynthesis
MW 31.7 kDa
Summary This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CH25H (NM_003956) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204716L1 Lenti ORF clone of Human cholesterol 25-hydroxylase (CH25H), Myc-DDK-tagged 10 ug
$600.00
RC204716L2 Lenti ORF clone of Human cholesterol 25-hydroxylase (CH25H), mGFP tagged 10 ug
$600.00
RC204716L3 Lenti ORF clone of Human cholesterol 25-hydroxylase (CH25H), Myc-DDK-tagged 10 ug
$600.00
RC204716L4 Lenti ORF clone of Human cholesterol 25-hydroxylase (CH25H), mGFP tagged 10 ug
$600.00
RG204716 CH25H (tGFP-tagged) - Human cholesterol 25-hydroxylase (CH25H) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC125616 CH25H (untagged)-Human cholesterol 25-hydroxylase (CH25H) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.